TWEAKR (TNFRSF12A) (NM_016639) Human Tagged ORF Clone

SKU
RG201041
TNFRSF12A (tGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TWEAKR
Synonyms CD266; FN14; TWEAKR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201041 representing NM_016639
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGGGGCTCGCTGCGCCGGTTGCTGCGGCTCCTCGTGCTGGGGCTCTGGCTGGCGTTGCTGCGCT
CCGTGGCCGGGGAGCAAGCGCCAGGCACCGCCCCCTGCTCCCGCGGCAGCTCCTGGAGCGCGGACCTGGA
CAAGTGCATGGACTGCGCGTCTTGCAGGGCGCGACCGCACAGCGACTTCTGCCTGGGCTGCGCTGCAGCA
CCTCCTGCCCCCTTCCGGCTGCTTTGGCCCATCCTTGGGGGCGCTCTGAGCCTGACCTTCGTGCTGGGGC
TGCTTTCTGGCTTTTTGGTCTGGAGACGATGCCGCAGGAGAGAGAAGTTCACCACCCCCATAGAGGAGAC
CGGCGGAGAGGGCTGCCCAGCTGTGGCGCTGATCCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201041 representing NM_016639
Red=Cloning site Green=Tags(s)

MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA
PPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016639
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016639.3
RefSeq Size 998 bp
RefSeq ORF 390 bp
Locus ID 51330
UniProt ID Q9NP84
Cytogenetics 16p13.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Summary Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TWEAKR (TNFRSF12A) (NM_016639) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201041 TNFRSF12A (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A) 10 ug
$150.00
RC201041L1 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A), Myc-DDK-tagged 10 ug
$450.00
RC201041L2 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A), mGFP tagged 10 ug
$450.00
RC201041L3 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A), Myc-DDK-tagged 10 ug
$450.00
RC201041L4 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A), mGFP tagged 10 ug
$450.00
SC114174 TNFRSF12A (untagged)-Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.