POLR2L (NM_021128) Human Tagged ORF Clone

SKU
RG200649
POLR2L (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol POLR2L
Synonyms hRPB7.6; RBP10; RPABC5; RPB7.6; RPB10; RPB10beta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200649 representing NM_021128
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCATCCCTGTACGCTGCTTCACTTGTGGCAAGATCGTCGGCAACAAGTGGGAGGCTTACCTGGGGC
TGCTGCAGGCCGAGTACACCGAGGGGGACGCGCTGGATGCCCTGGGCCTGAAGCGCTACTGCTGCCGCCG
GATGCTGCTGGCCCACGTGGACCTGATCGAGAAGCTGCTCAATTATGCACCCCTGGAGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200649 representing NM_021128
Red=Cloning site Green=Tags(s)

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021128
ORF Size 201 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021128.3, NP_066951.1
RefSeq Size 927 bp
RefSeq ORF 204 bp
Locus ID 5441
UniProt ID P62875
Cytogenetics 11p15.5
Domains RNA_pol_N
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Summary This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:POLR2L (NM_021128) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200649 POLR2L (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L) 10 ug
$150.00
RC200649L3 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L), Myc-DDK-tagged 10 ug
$450.00
RC200649L4 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L), mGFP tagged 10 ug
$450.00
SC112974 POLR2L (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.