CKS2 (NM_001827) Human Tagged ORF Clone

SKU
RG200491
CKS2 (tGFP-tagged) - Human CDC28 protein kinase regulatory subunit 2 (CKS2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CKS2
Synonyms CKSHS2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200491 representing NM_001827
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCACAAGCAGATCTACTACTCGGACAAGTACTTCGACGAACACTACGAGTACCGGCATGTTATGT
TACCCAGAGAACTTTCCAAACAAGTACCTAAAACTCATCTGATGTCTGAAGAGGAGTGGAGGAGACTTGG
TGTCCAACAGAGTCTAGGCTGGGTTCATTACATGATTCATGAGCCAGAACCACATATTCTTCTCTTTAGA
CGACCTCTTCCAAAAGATCAACAAAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200491 representing NM_001827
Red=Cloning site Green=Tags(s)

MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR
RPLPKDQQK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001827
ORF Size 237 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001827.3
RefSeq Size 627 bp
RefSeq ORF 240 bp
Locus ID 1164
UniProt ID P33552
Cytogenetics 9q22.2
Domains CKS
Protein Families Druggable Genome, Stem cell - Pluripotency
Summary CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CKS2 (NM_001827) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200491 CKS2 (Myc-DDK-tagged)-Human CDC28 protein kinase regulatory subunit 2 (CKS2) 10 ug
$150.00
RC200491L3 Lenti ORF clone of Human CDC28 protein kinase regulatory subunit 2 (CKS2), Myc-DDK-tagged 10 ug
$450.00
RC200491L4 Lenti ORF clone of Human CDC28 protein kinase regulatory subunit 2 (CKS2), mGFP tagged 10 ug
$450.00
SC127099 CKS2 (untagged)-Human CDC28 protein kinase regulatory subunit 2 (CKS2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.