MPV17 (NM_002437) Human Tagged ORF Clone

SKU
RG200452
MPV17 (tGFP-tagged) - Human MpV17 mitochondrial inner membrane protein (MPV17), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MPV17
Synonyms CMT2EE; MTDPS6; SYM1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200452 representing NM_002437
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACTCTGGCGGGCATACCAGCGGGCCCTGGCCGCTCACCCGTGGAAAGTACAGGTCCTGACAGCTG
GGTCCCTGATGGGCCTGGGTGACATTATCTCACAGCAGCTGGTGGAGAGGCGGGGTCTGCAGGAACACCA
GAGAGGCCGGACTCTGACCATGGTGTCCCTGGGCTGTGGCTTTGTGGGCCCTGTGGTAGGAGGCTGGTAC
AAGGTTTTGGATCGGTTCATCCCTGGCACCACCAAAGTGGATGCACTGAAGAAGATGTTGTTGGATCAGG
GGGGCTTTGCCCCGTGTTTTCTAGGCTGCTTTCTCCCACTGGTAGGGGCACTTAATGGACTGTCAGCCCA
GGACAACTGGGCCAAACTACAGCGGGATTATCCTGATGCCCTTATCACCAACTACTATCTATGGCCTGCT
GTGCAGTTAGCCAACTTCTACCTGGTCCCCCTTCATTACAGGTTGGCCGTTGTCCAATGTGTTGCTGTTA
TCTGGAACTCCTACCTGTCCTGGAAGGCACATCGGCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200452 representing NM_002437
Red=Cloning site Green=Tags(s)

MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWY
KVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPA
VQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002437
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002437.5
RefSeq Size 1042 bp
RefSeq ORF 531 bp
Locus ID 4358
UniProt ID P39210
Cytogenetics 2p23.3
Domains Mpv17_PMP22
Protein Families Transmembrane
Summary This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MPV17 (NM_002437) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200452 MPV17 (Myc-DDK-tagged)-Human MpV17 mitochondrial inner membrane protein (MPV17), nuclear gene encoding mitochondrial protein 10 ug
$300.00
RC200452L1 Lenti ORF clone of Human MpV17 mitochondrial inner membrane protein (MPV17), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC200452L2 Lenti ORF clone of Human MpV17 mitochondrial inner membrane protein (MPV17), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC200452L3 Lenti ORF clone of Human MpV17 mitochondrial inner membrane protein (MPV17), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC200452L4 Lenti ORF clone of Human MpV17 mitochondrial inner membrane protein (MPV17), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
SC118652 MPV17 (untagged)-Human MpV17 mitochondrial inner membrane protein (MPV17), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.