UBE2G2 (NM_003343) Human Tagged ORF Clone

SKU
RG200407
UBE2G2 (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBE2G2
Synonyms UBC7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200407 representing NM_003343
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGACCGCGCTCAAGAGGCTGATGGCCGAGTACAAACAATTAACACTGAATCCTCCGGAAGGAA
TTGTAGCAGGCCCCATGAATGAAGAGAACTTTTTTGAATGGGAGGCATTGATCATGGGCCCAGAAGACAC
CTGCTTTGAGTTTGGTGTTTTTCCTGCCATCCTGAGTTTCCCACTTGATTACCCGTTAAGTCCCCCAAAG
ATGAGATTTACCTGTGAGATGTTTCATCCCAACATCTACCCTGATGGGAGAGTCTGCATTTCCATCCTCC
ACGCGCCAGGCGATGACCCCATGGGCTACGAGAGCAGCGCGGAGCGGTGGAGTCCTGTGCAGAGTGTGGA
GAAGATCCTGCTGTCGGTGGTGAGCATGCTGGCAGAGCCCAATGACGAAAGTGGAGCTAACGTGGATGCG
TCCAAAATGTGGCGCGATGACCGGGAGCAGTTCTATAAGATTGCCAAGCAGATCGTCCAGAAGTCTCTGG
GACTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200407 representing NM_003343
Red=Cloning site Green=Tags(s)

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPK
MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDA
SKMWRDDREQFYKIAKQIVQKSLGL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003343
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003343.6
RefSeq Size 2919 bp
RefSeq ORF 498 bp
Locus ID 7327
UniProt ID P60604
Cytogenetics 21q22.3
Domains UBCc
Protein Families Druggable Genome
Protein Pathways Parkinson's disease, Ubiquitin mediated proteolysis
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Write Your Own Review
You're reviewing:UBE2G2 (NM_003343) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200407 UBE2G2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 1 10 ug
$150.00
RC200407L1 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC200407L2 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 1, mGFP tagged 10 ug
$450.00
RC200407L3 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC200407L4 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 1, mGFP tagged 10 ug
$450.00
SC118048 UBE2G2 (untagged)-Human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.