FAM32A (NM_014077) Human Tagged ORF Clone

SKU
RG200334
FAM32A (tGFP-tagged) - Human family with sequence similarity 32, member A (FAM32A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FAM32A
Synonyms OTAG-12; OTAG12
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200334 representing NM_014077
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCTACGAGCAGGTCCAAAAGGGACCCCTGAAGCTGAAAGGCGTCGCAGAGCTGGGAGTGACCA
AGCGGAAGAAGAAAAAGAAGGACAAAGACAAAGCGAAACTCCTGGAAGCAATGGGAACGAGCAAAAAGAA
CGAGGAGGAGAAGCGGCGCGGCCTGGACAAGCGGACCCCGGCCCAGGCGGCCTTCGAGAAAATGCAGGAG
AAGCGGCAAATGGAAAGGATCCTAAAGAAGGCATCCAAAACCCACAAGCAGAGAGTGGAGGACTTCAACA
GACACCTGGACACACTCACGGAGCATTACGACATTCCCAAAGTCAGCTGGACGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200334 representing NM_014077
Red=Cloning site Green=Tags(s)

MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE
KRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014077
ORF Size 336 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014077.4
RefSeq Size 1465 bp
RefSeq ORF 339 bp
Locus ID 26017
UniProt ID Q9Y421
Cytogenetics 19p13.11
Summary Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:FAM32A (NM_014077) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200334 FAM32A (Myc-DDK-tagged)-Human family with sequence similarity 32, member A (FAM32A) 10 ug
$150.00
RC200334L3 Lenti ORF clone of Human family with sequence similarity 32, member A (FAM32A), Myc-DDK-tagged 10 ug
$450.00
RC200334L4 Lenti ORF clone of Human family with sequence similarity 32, member A (FAM32A), mGFP tagged 10 ug
$450.00
SC115171 FAM32A (untagged)-Human family with sequence similarity 32, member A (FAM32A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.