LSM1 (NM_014462) Human Tagged ORF Clone

SKU
RG200288
LSM1 (tGFP-tagged) - Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LSM1
Synonyms CASM; YJL124C
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200288 representing NM_014462
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTATATGCCTGGCACCGCCAGCCTCATCGAGGACATTGACAAAAAGCACTTGGTTCTGCTTCGAG
ATGGAAGGACACTTATAGGCTTTTTAAGAAGCATTGATCAATTTGCAAACTTAGTGCTACATCAGACTGT
GGAGCGTATTCATGTGGGCAAAAAATACGGTGATATTCCTCGAGGGATTTTTGTGGTCAGAGGAGAAAAT
GTGGTCCTACTAGGAGAAATAGACTTGGAAAAGGAGAGTGACACACCCCTCCAGCAAGTATCCATTGAAG
AAATTCTAGAAGAACAAAGGGTGGAACAGCAGACCAAGCTGGAAGCAGAGAAGTTGAAAGTGCAGGCCCT
GAAGGACCGAGGTCTTTCCATTCCTCGAGCAGATACTCTTGATGAGTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200288 representing NM_014462
Red=Cloning site Green=Tags(s)

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN
VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014462
ORF Size 399 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014462.3
RefSeq Size 935 bp
RefSeq ORF 402 bp
Locus ID 27257
UniProt ID O15116
Cytogenetics 8p11.23
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Summary This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011]
Write Your Own Review
You're reviewing:LSM1 (NM_014462) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200288 LSM1 (Myc-DDK-tagged)-Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) 10 ug
$150.00
RC200288L1 Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), Myc-DDK-tagged 10 ug
$450.00
RC200288L2 Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), mGFP tagged 10 ug
$450.00
RC200288L3 Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), Myc-DDK-tagged 10 ug
$450.00
RC200288L4 Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), mGFP tagged 10 ug
$450.00
SC125809 LSM1 (untagged)-Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.