IPP 2 (PPP1R2) (NM_006241) Human Tagged ORF Clone

SKU
RG200280
PPP1R2 (tGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IPP 2
Synonyms IPP-2; IPP2; PPP1R2A
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200280 representing NM_006241
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCTCGACGGCCTCGCACCGGCCCATCAAGGGGATCTTGAAGAACAAGACCTCTACGACTTCCT
CTATGGTGGCGTCGGCCGAACAGCCCCGCGGGAATGTCGACGAGGAGCTGAGCAAAAAATCCCAGAAGTG
GGATGAAATGAACATCTTGGCGACGTATCATCCAGCAGACAAAGACTATGGTTTAATGAAAATAGATGAA
CCAAGCACTCCTTACCATAGTATGATGGGGGATGATGAAGATGCCTGTAGTGACACCGAGGCCACTGAAG
CCATGGCGCCAGACATCTTAGCCAGGAAATTAGCTGCAGCTGAAGGCTTGGAGCCAAAGTATCGGATTCA
GGAACAAGAAAGCAGTGGAGAGGAGGATAGTGACCTCTCACCTGAAGAACGAGAAAAAAAGCGACAATTT
GAAATGAAAAGGAAGCTTCACTACAATGAAGGACTCAATATCAAACTAGCCAGACAATTAATTTCAAAAG
ACCTACATGATGATGATGAAGATGAAGAAATGTTAGAGACTGCAGATGGAGAAAGCATGAATACGGAAGA
ATCAAATCAAGGATCTACTCCAAGTGACCAACAGCAAAACAAATTACGAAGTTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200280 representing NM_006241
Red=Cloning site Green=Tags(s)

MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDE
PSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF
EMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006241
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006241.8
RefSeq Size 3346 bp
RefSeq ORF 618 bp
Locus ID 5504
UniProt ID P41236
Cytogenetics 3q29
Domains IPP-2
Protein Families Druggable Genome
Summary Protein phosphatase-1 (PP1) is one of the main eukaryotic serine/threonine phosphatases. The protein encoded by this gene binds to the catalytic subunit of PP1, strongly inhibiting its activity. Ten related pseudogenes have been found throughout the human genome. Several splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:IPP 2 (PPP1R2) (NM_006241) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200280 PPP1R2 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2) 10 ug
$300.00
RC200280L1 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2), Myc-DDK-tagged 10 ug
$600.00
RC200280L2 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2), mGFP tagged 10 ug
$600.00
RC200280L3 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2), Myc-DDK-tagged 10 ug
$600.00
RC200280L4 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2), mGFP tagged 10 ug
$600.00
SC116238 PPP1R2 (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.