COPS8 (NM_198189) Human Tagged ORF Clone

SKU
RG200267
COPS8 (tGFP-tagged) - Human COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) (COPS8), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COPS8
Synonyms COP9; CSN8; SGN8
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200267 representing NM_198189
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGTGGCGGTGATGGCGGAAAGCGCCTTTAGTTTCAAAAAGTTGCTGGATCAGTGCGAGAACCAGG
AGCTCGAGGCCCCTGGAGGAATTGCTACACCCCCAGTGTATGGTCAGCTTCTAGCTTTATATTTGCTCCA
TAATGACATGAATAATGCAAGATATCTTTGGAAAAGAATACCACCTGCTATAAAATCTGCAAATTCTGAA
CTTGGGGGAATTTGGTCAGTAGGACAAAGAATCTGGCAGAGAGATTTCCCTGGGATCTATACAACCATCA
ACGCTCACCAGTGGTCTGAGACGGTCCAGCCAATTATGGAAGCACTTAGAGATGCAACAAGGAGACGCGC
CTTTGCCCTGGTCTCTCAAGCGTATACTTCAATCATCGCCGATGATTTTGCAGCCTTTGTTGGACTTCCT
GTAGAAGAGGCTGTGAAAGGCATATTAGAACAAGGATGGCAAGCTGATTCCACCACAAGAATGGTTCTGC
CCAGAAAGCCAGTTGCAGGGGCCCTGGATGTTTCCTTTAACAAGTTTATTCCCTTATCAGAGCCTGCTCC
AGTTCCCCCAATACCCAATGAACAGCAGTTAGCCAGACTGACGGATTATGTGGCTTTCCTTGAAAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200267 representing NM_198189
Red=Cloning site Green=Tags(s)

MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSE
LGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLP
VEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198189
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198189.2, NP_937832.1
RefSeq Size 2339 bp
RefSeq ORF 483 bp
Locus ID 10920
UniProt ID Q99627
Cytogenetics 2q37.3
Summary The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:COPS8 (NM_198189) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200267 COPS8 (Myc-DDK-tagged)-Human COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) (COPS8), transcript variant 2 10 ug
$300.00
RC200267L3 Lenti ORF clone of Human COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) (COPS8), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200267L4 Lenti ORF clone of Human COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) (COPS8), transcript variant 2, mGFP tagged 10 ug
$600.00
SC111899 COPS8 (untagged)-Human COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) (COPS8), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.