Sumo 3 (SUMO3) (NM_006936) Human Tagged ORF Clone

SKU
RG200241
SUMO3 (tGFP-tagged) - Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Sumo 3
Synonyms SMT3A; Smt3B; SMT3H1; SUMO-3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200241 representing NM_006936
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGAGGAGAAGCCCAAGGAGGGTGTGAAGACAGAGAATGACCACATCAACCTGAAGGTGGCCGGGC
AGGACGGCTCCGTGGTGCAGTTCAAGATCAAGAGGCACACGCCGCTGAGCAAGCTGATGAAGGCCTACTG
CGAGAGGCAGGGCTTGTCAATGAGGCAGATCAGATTCAGGTTCGACGGGCAGCCAATCAATGAAACTGAC
ACTCCAGCACAGCTGGAGATGGAGGACGAGGACACCATCGACGTGTTCCAGCAGCAGACGGGAGGTGTGC
CGGAGAGCAGCCTGGCAGGGCACAGTTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200241 representing NM_006936
Red=Cloning site Green=Tags(s)

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD
TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006936
ORF Size 309 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006936.3
RefSeq Size 1831 bp
RefSeq ORF 312 bp
Locus ID 6612
UniProt ID P55854
Cytogenetics 21q22.3
Domains UBQ
Protein Families Druggable Genome
Summary This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]
Write Your Own Review
You're reviewing:Sumo 3 (SUMO3) (NM_006936) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200241 SUMO3 (Myc-DDK-tagged)-Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) 10 ug
$150.00
RC200241L1 Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), Myc-DDK-tagged 10 ug
$450.00
RC200241L2 Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), mGFP tagged 10 ug
$450.00
RC200241L3 Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), Myc-DDK-tagged 10 ug
$450.00
RC200241L4 Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), mGFP tagged 10 ug
$450.00
SC115792 SUMO3 (untagged)-Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.