DUSP23 (NM_017823) Human Tagged ORF Clone

SKU
RG200171
DUSP23 (tGFP-tagged) - Human dual specificity phosphatase 23 (DUSP23)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP23
Synonyms DUSP25; LDP-3; LDP3; MOSP; VHZ
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200171 representing NM_017823
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGTGCAGCCCCCCAACTTCTCCTGGGTGCTTCCGGGCCGGCTGGCGGGACTGGCGCTGCCGCGGC
TCCCCGCCCACTACCAGTTCCTGTTGGACCTGGGCGTGCGGCACCTGGTGTCCCTGACGGAGCGCGGGCC
CCCTCACAGCGACAGCTGCCCCGGCCTCACCCTGCACCGCCTGCGCATCCCCGACTTCTGCCCGCCGGCC
CCCGACCAGATCGACCGCTTCGTGCAGATCGTGGACGAGGCCAACGCACGGGGAGAGGCTGTGGGAGTGC
ACTGTGCTCTGGGCTTTGGCCGCACTGGCACCATGCTGGCCTGTTACCTGGTGAAGGAGCGGGGCTTGGC
TGCAGGAGATGCCATTGCTGAAATCCGACGACTACGACCCGGCTCCATCGAGACCTATGAGCAGGAGAAA
GCAGTCTTCCAGTTCTACCAGCGAACGAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200171 representing NM_017823
Red=Cloning site Green=Tags(s)

MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA
PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK
AVFQFYQRTK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017823
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017823.5
RefSeq Size 718 bp
RefSeq ORF 453 bp
Locus ID 54935
UniProt ID Q9BVJ7
Cytogenetics 1q23.2
Domains DSPc, PTPc_motif
Protein Families Druggable Genome, Phosphatase
Summary Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DUSP23 (NM_017823) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200171 DUSP23 (Myc-DDK-tagged)-Human dual specificity phosphatase 23 (DUSP23) 10 ug
$150.00
RC200171L1 Lenti ORF clone of Human dual specificity phosphatase 23 (DUSP23), Myc-DDK-tagged 10 ug
$450.00
RC200171L2 Lenti ORF clone of Human dual specificity phosphatase 23 (DUSP23), mGFP tagged 10 ug
$450.00
RC200171L3 Lenti ORF clone of Human dual specificity phosphatase 23 (DUSP23), Myc-DDK-tagged 10 ug
$450.00
RC200171L4 Lenti ORF clone of Human dual specificity phosphatase 23 (DUSP23), mGFP tagged 10 ug
$450.00
SC108678 DUSP23 (untagged)-Human dual specificity phosphatase 23 (DUSP23) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.