SNRNP25 (NM_024571) Human Tagged ORF Clone

SKU
RG200010
SNRNP25 (tGFP-tagged) - Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SNRNP25
Synonyms C16orf33
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200010 representing NM_024571
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTGTTCCAGGAGGGTCTGGCTATGGTGGTGCAGGACCCGCTGCTCTGCGATCTGCCGATCCAGG
TTACTCTGGAAGAAGTCAACTCCCAAATAGCCCTAGAATACGGCCAGGCAATGACGGTCCGAGTGTGCAA
GATGGATGGAGAAGTAATGCCCGTGGTTGTAGTGCAGAGTGCCACAGTCCTGGACCTGAAGAAGGCCATC
CAGAGATACGTGCAGCTCAAGCAGGAGCGTGAAGGGGGCATTCAGCACATCAGCTGGTCCTACGTGTGGA
GGACGTACCATCTGACCTCTGCAGGAGAGAAACTCACGGAAGACAGAAAGAAGCTCCGAGACTACGGCAT
CCGGAATCGAGACGAGGTTTCCTTCATCAAAAAGCTGAGGCAAAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200010 representing NM_024571
Red=Cloning site Green=Tags(s)

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI
QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024571
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024571.3
RefSeq Size 1695 bp
RefSeq ORF 372 bp
Locus ID 79622
UniProt ID Q9BV90
Cytogenetics 16p13.3
Protein Families Druggable Genome
Summary Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010]
Write Your Own Review
You're reviewing:SNRNP25 (NM_024571) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200010 SNRNP25 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25) 10 ug
$150.00
RC200010L3 Lenti ORF clone of Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25), Myc-DDK-tagged 10 ug
$450.00
RC200010L4 Lenti ORF clone of Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25), mGFP tagged 10 ug
$450.00
SC112188 SNRNP25 (untagged)-Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.