TMEM16A(ANO1) (NM_018043) Human Tagged ORF Clone

CAT#: RC229400

ANO1 (Myc-DDK-tagged)-Human anoctamin 1, calcium activated chloride channel (ANO1), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,504.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TMEM16A(ANO1) (NM_018043) Human Tagged ORF Clone
Symbol ANO1
Synonyms DOG1; ORAOV2; TAOS2; TMEM16A
Vector pCMV6-Entry
Sequence Data
>RC229400 representing NM_018043
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGTCAACGAGAAGTACTCGACGCTCCCGGCCGAGGACCGCAGCGTCCACATCATCAACATCTGCG
CCATCGAGGACATCGGCTACCTGCCGTCCGAGGGCACGCTGCTGAACTCCTTATCTGTGGACCCTGATGC
CGAGTGCAAGTATGGCCTGTACTTCAGGGACGGCCGGCGCAAGGTGGACTACATCCTGGTGTACCATCAC
AAGAGGCCCTCGGGCAACCGGACCCTGGTCAGGAGGGTGCAGCACAGCGACACCCCCTCTGGGGCTCGCA
GCGTCAAGCAGGACCACCCCCTGCCGGGCAAGGGGGCGTCGCTGGATGCAGGCTCGGGGGAGCCCCCGAT
GGACTACCACGAGGATGACAAGCGCTTCCGCAGGGAGGAGTACGAGGGCAACCTCCTGGAGGCGGGCCTG
GAGCTGGAGCGGGACGAGGACACTAAAATCCACGGAGTCGGGTTTGTGAAAATCCATGCCCCCTGGAACG
TGCTGTGCAGAGAGGCCGAGTTTCTGAAACTGAAGATGCCGACGAAGAAGATGTACCACATTAATGAGAC
CCGTGGCCTCCTGAAAAAAATCAACTCTGTGCTCCAGAAAATCACAGATCCCATCCAGCCCAAAGTGGCT
GAGCACAGGCCCCAGACCATGAAGAGACTCTCCTATCCCTTCTCCCGGGAGAAGCAGCATCTATTTGACT
TGTCTGATAAGGATTCCTTTTTCGACAGCAAAACCCGGAGCACGATTGTCTATGAGATCTTGAAGAGAAC
GACGTGTACAAAGGCCAAGTACAGCATGGGCATCACGAGCCTGCTGGCCAATGGTGTGTACGCGGCTGCA
TACCCACTGCACGATGGAGACTACAACGGTGAAAACGTCGAGTTCAACGACAGAAAACTCCTGTACGAAG
AGTGGGCACGCTATGGAGTTTTCTATAAGTACCAGCCCATCGACCTGGTCAGGAAGTATTTTGGGGAGAA
GATCGGCCTGTACTTCGCCTGGCTGGGCGTGTACACCCAGATGCTCATCCCTGCCTCCATCGTGGGAATC
ATTGTCTTCCTGTACGGATGCGCCACCATGGATGAAAACATCCCCAGCATGGAGATGTGTGACCAGAGAC
ACAATATCACCATGTGCCCGCTTTGCGACAAGACCTGCAGCTACTGGAAGATGAGCTCAGCCTGCGCCAC
GGCCCGCGCCAGCCACCTCTTCGACAACCCCGCCACGGTCTTCTTCTCTGTCTTCATGGCCCTCTGGGCT
GCCACCTTCATGGAGCACTGGAAGCGGAAACAGATGCGACTCAACTACCGCTGGGACCTCACGGGCTTTG
AAGAGGAAGAGGAGGCTGTCAAGGATCATCCTAGAGCTGAATACGAAGCCAGAGTCTTGGAGAAGTCTCT
GAAGAAAGAGTCCAGAAACAAAGAGAAGCGCCGGCATATTCCAGAGGAGTCAACAAACAAATGGAAGCAG
AGGGTTAAGACAGCCATGGCGGGGGTGAAATTGACTGACAAAGTGAAGCTGACATGGAGAGATCGGTTCC
CAGCCTACCTCACTAACTTGGTCTCCATCATCTTCATGATTGCAGTGACGTTTGCCATCGTCCTCGGCGT
CATCATCTACAGAATCTCCATGGCCGCCGCCTTGGCCATGAACTCCTCCCCCTCCGTGCGGTCCAACATC
CGGGTCACAGTCACAGCCACCGCAGTCATCATCAACCTAGTGGTCATCATCCTCCTGGACGAGGTGTATG
GCTGCATAGCCCGATGGCTCACCAAGATCGAGGTCCCAAAGACGGAGAAAAGCTTTGAGGAGAGGCTGAT
CTTCAAGGCTTTCCTGCTGAAGTTTGTGAATTCCTACACCCCCATCTTTTACGTGGCGTTCTTCAAAGGC
CGGTTTGTTGGACGCCCGGGCGACTACGTGTACATTTTCCGTTCCTTCCGAATGGAAGAGTGTGCGCCAG
GGGGCTGCCTGATGGAGCTATGCATCCAGCTCAGCATCATCATGCTGGGGAAACAGCTGATCCAGAACAA
CCTGTTCGAGATCGGCATCCCGAAGATGAAGAAGCTCATCCGCTACCTGAAGCTGAAGCAGCAGAGCCCC
CCTGACCACGAGGAGTGTGTGAAGAGGAAACAGCGGTACGAGGTGGATTACAACCTGGAGCCCTTCGCGG
GCCTCACCCCAGAGTACATGGAAATGATCATCCAGTTTGGCTTCGTCACCCTGTTTGTCGCCTCCTTCCC
CCTGGCCCCACTGTTTGCGCTGCTGAACAACATCATCGAGATCCGCCTGGACGCCAAAAAGTTTGTCACT
GAGCTCCGAAGGCCGGTAGCTGTCAGAGCCAAAGACATCGGAATCTGGTACAATATCCTCAGAGGCATTG
GGAAGCTTGCTGTCATCATCAATGCCTTCGTGATCTCCTTCACGTCTGACTTCATCCCGCGCCTGGTGTA
CCTCTACATGTACAGTAAGAACGGGACCATGCACGGCTTCGTCAACCACACCCTCTCCTCCTTCAACGTC
AGTGACTTCCAGAACGGCACGGCCCCCAATGACCCCCTGGACCTGGGCTACGAGGTGCAGATCTGCAGGT
ATAAAGACTACCGAGAGCCGCCGTGGTCGGAAAACAAGTACGACATCTCCAAGGACTTCTGGGCCGTCCT
GGCAGCCCGGCTGGCGTTTGTCATCGTCTTCCAGAACCTGGTCATGTTCATGAGCGACTTTGTGGACTGG
GTCATCCCGGACATCCCCAAGGACATCAGCCAGCAGATCCACAAGGAGAAGGTGCTCATGGTGGAGCTGT
TCATGCGGGAGGAGCAAGACAAGCAGCAGCTGCTGGAAACCTGGATGGAGAAGGAGCGGCAGAAGGACGA
GCCGCCGTGCAACCACCACAACACCAAAGCCTGCCCAGACAGCCTCGGCAGCCCAGCCCCCAGCCATGCC
TACCACGGGGGCGTCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229400 representing NM_018043
Red=Cloning site Green=Tags(s)

MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHH
KRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGL
ELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVA
EHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAA
YPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI
IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQ
RVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNI
RVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKG
RFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP
PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVT
ELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV
SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDW
VIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHA
YHGGVL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018043
ORF Size 2958 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018043.5, NP_060513
RefSeq ORF 2961
Locus ID 55107
Cytogenetics 11q13.3
Domains DUF590
Protein Families Transmembrane
MW 113.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)