TMEM16A (ANO1) (NM_018043) Human Tagged ORF Clone

CAT#: RC229400

Reviews ()
Write a review
  • TrueORF®

ANO1 (Myc-DDK-tagged)-Human anoctamin 1, calcium activated chloride channel (ANO1), transcript variant 1



  "NM_018043" in other vectors (11)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,168.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ANO1
Synonyms DOG1; ORAOV2; TAOS2; TMEM16A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229400 representing NM_018043
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGTCAACGAGAAGTACTCGACGCTCCCGGCCGAGGACCGCAGCGTCCACATCATCAACATCTGCG
CCATCGAGGACATCGGCTACCTGCCGTCCGAGGGCACGCTGCTGAACTCCTTATCTGTGGACCCTGATGC
CGAGTGCAAGTATGGCCTGTACTTCAGGGACGGCCGGCGCAAGGTGGACTACATCCTGGTGTACCATCAC
AAGAGGCCCTCGGGCAACCGGACCCTGGTCAGGAGGGTGCAGCACAGCGACACCCCCTCTGGGGCTCGCA
GCGTCAAGCAGGACCACCCCCTGCCGGGCAAGGGGGCGTCGCTGGATGCAGGCTCGGGGGAGCCCCCGAT
GGACTACCACGAGGATGACAAGCGCTTCCGCAGGGAGGAGTACGAGGGCAACCTCCTGGAGGCGGGCCTG
GAGCTGGAGCGGGACGAGGACACTAAAATCCACGGAGTCGGGTTTGTGAAAATCCATGCCCCCTGGAACG
TGCTGTGCAGAGAGGCCGAGTTTCTGAAACTGAAGATGCCGACGAAGAAGATGTACCACATTAATGAGAC
CCGTGGCCTCCTGAAAAAAATCAACTCTGTGCTCCAGAAAATCACAGATCCCATCCAGCCCAAAGTGGCT
GAGCACAGGCCCCAGACCATGAAGAGACTCTCCTATCCCTTCTCCCGGGAGAAGCAGCATCTATTTGACT
TGTCTGATAAGGATTCCTTTTTCGACAGCAAAACCCGGAGCACGATTGTCTATGAGATCTTGAAGAGAAC
GACGTGTACAAAGGCCAAGTACAGCATGGGCATCACGAGCCTGCTGGCCAATGGTGTGTACGCGGCTGCA
TACCCACTGCACGATGGAGACTACAACGGTGAAAACGTCGAGTTCAACGACAGAAAACTCCTGTACGAAG
AGTGGGCACGCTATGGAGTTTTCTATAAGTACCAGCCCATCGACCTGGTCAGGAAGTATTTTGGGGAGAA
GATCGGCCTGTACTTCGCCTGGCTGGGCGTGTACACCCAGATGCTCATCCCTGCCTCCATCGTGGGAATC
ATTGTCTTCCTGTACGGATGCGCCACCATGGATGAAAACATCCCCAGCATGGAGATGTGTGACCAGAGAC
ACAATATCACCATGTGCCCGCTTTGCGACAAGACCTGCAGCTACTGGAAGATGAGCTCAGCCTGCGCCAC
GGCCCGCGCCAGCCACCTCTTCGACAACCCCGCCACGGTCTTCTTCTCTGTCTTCATGGCCCTCTGGGCT
GCCACCTTCATGGAGCACTGGAAGCGGAAACAGATGCGACTCAACTACCGCTGGGACCTCACGGGCTTTG
AAGAGGAAGAGGAGGCTGTCAAGGATCATCCTAGAGCTGAATACGAAGCCAGAGTCTTGGAGAAGTCTCT
GAAGAAAGAGTCCAGAAACAAAGAGAAGCGCCGGCATATTCCAGAGGAGTCAACAAACAAATGGAAGCAG
AGGGTTAAGACAGCCATGGCGGGGGTGAAATTGACTGACAAAGTGAAGCTGACATGGAGAGATCGGTTCC
CAGCCTACCTCACTAACTTGGTCTCCATCATCTTCATGATTGCAGTGACGTTTGCCATCGTCCTCGGCGT
CATCATCTACAGAATCTCCATGGCCGCCGCCTTGGCCATGAACTCCTCCCCCTCCGTGCGGTCCAACATC
CGGGTCACAGTCACAGCCACCGCAGTCATCATCAACCTAGTGGTCATCATCCTCCTGGACGAGGTGTATG
GCTGCATAGCCCGATGGCTCACCAAGATCGAGGTCCCAAAGACGGAGAAAAGCTTTGAGGAGAGGCTGAT
CTTCAAGGCTTTCCTGCTGAAGTTTGTGAATTCCTACACCCCCATCTTTTACGTGGCGTTCTTCAAAGGC
CGGTTTGTTGGACGCCCGGGCGACTACGTGTACATTTTCCGTTCCTTCCGAATGGAAGAGTGTGCGCCAG
GGGGCTGCCTGATGGAGCTATGCATCCAGCTCAGCATCATCATGCTGGGGAAACAGCTGATCCAGAACAA
CCTGTTCGAGATCGGCATCCCGAAGATGAAGAAGCTCATCCGCTACCTGAAGCTGAAGCAGCAGAGCCCC
CCTGACCACGAGGAGTGTGTGAAGAGGAAACAGCGGTACGAGGTGGATTACAACCTGGAGCCCTTCGCGG
GCCTCACCCCAGAGTACATGGAAATGATCATCCAGTTTGGCTTCGTCACCCTGTTTGTCGCCTCCTTCCC
CCTGGCCCCACTGTTTGCGCTGCTGAACAACATCATCGAGATCCGCCTGGACGCCAAAAAGTTTGTCACT
GAGCTCCGAAGGCCGGTAGCTGTCAGAGCCAAAGACATCGGAATCTGGTACAATATCCTCAGAGGCATTG
GGAAGCTTGCTGTCATCATCAATGCCTTCGTGATCTCCTTCACGTCTGACTTCATCCCGCGCCTGGTGTA
CCTCTACATGTACAGTAAGAACGGGACCATGCACGGCTTCGTCAACCACACCCTCTCCTCCTTCAACGTC
AGTGACTTCCAGAACGGCACGGCCCCCAATGACCCCCTGGACCTGGGCTACGAGGTGCAGATCTGCAGGT
ATAAAGACTACCGAGAGCCGCCGTGGTCGGAAAACAAGTACGACATCTCCAAGGACTTCTGGGCCGTCCT
GGCAGCCCGGCTGGCGTTTGTCATCGTCTTCCAGAACCTGGTCATGTTCATGAGCGACTTTGTGGACTGG
GTCATCCCGGACATCCCCAAGGACATCAGCCAGCAGATCCACAAGGAGAAGGTGCTCATGGTGGAGCTGT
TCATGCGGGAGGAGCAAGACAAGCAGCAGCTGCTGGAAACCTGGATGGAGAAGGAGCGGCAGAAGGACGA
GCCGCCGTGCAACCACCACAACACCAAAGCCTGCCCAGACAGCCTCGGCAGCCCAGCCCCCAGCCATGCC
TACCACGGGGGCGTCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229400 representing NM_018043
Red=Cloning site Green=Tags(s)

MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHH
KRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGL
ELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVA
EHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAA
YPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI
IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQ
RVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNI
RVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKG
RFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP
PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVT
ELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV
SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDW
VIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHA
YHGGVL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018043
ORF Size 2958 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018043.6
RefSeq ORF 2961 bp
Locus ID 55107
UniProt ID Q5XXA6
Cytogenetics 11q13.3
Domains DUF590
Protein Families Transmembrane
MW 113.9 kDa
Gene Summary Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "ANO1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


ANO1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.