Class A basic helix loop helix protein 9(BHLHA9) (NM_001164405) Human Tagged ORF Clone

CAT#: RC228166

BHLHA9 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member a9 (BHLHA9)

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Class A basic helix loop helix protein 9(BHLHA9) (NM_001164405) Human Tagged ORF Clone
Symbol BHLHA9
Synonyms BHLHF42; CCSPD
Vector pCMV6-Entry
Sequence Data
>RC228166 representing NM_001164405
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGGGGCGCGCCAGGACTAGGCCTCACGGCGCGGAAGGGGGCCGAGGACTCTGCGGAGGACTTGG
GGGGCCCCTGCCCCGAGCCCGGGGGCGATTCGGGGGTGCTGGGGGCGAACGGCGCTTCCTGCAGCCGGGG
CGAGGCGGAGGAGCCGGCGGGCAGGAGGCGCGCGCGGCCGGTGCGGTCCAAGGCGCGGCGCATGGCCGCC
AACGTGCGGGAGCGCAAGCGCATCCTAGACTACAACGAGGCCTTCAACGCGCTGCGCCGGGCGCTGCGGC
ACGACCTGGGCGGCAAGAGGCTCTCCAAGATCGCCACGCTGCGCAGGGCCATCCACCGCATCGCCGCGCT
CTCCCTGGTCCTGCGCGCCAGCCCCGCGCCCCGCGGGCCCTGCGGACACCTGGAGTGCCACGGCCCGGCC
GCGCGCGGGGACACCGGGGACACAGGCGCCAGCCCCCCGCCGCCTGCAGGGCCCAGCCTCGCGCGCCCAG
ACGCCGCCCGCCCCTCGGTGCCGTCCGCGCCCCGCTGCGCCTCGTGCCCCCCGCACGCGCCCCTGGCACG
GCCCAGTGCGGTGGCCGAGGGGCCGGGCCTAGCACAGGCCTCCGGGGGAAGCTGGCGCCGCTGTCCGGGG
GCTTCCTCTGCCGGGCCGCCTCCCTGGCCGCGGGGCTACCTGCGATCCGCCCCCGGGATGGGCCATCCGC
GCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228166 representing NM_001164405
Red=Cloning site Green=Tags(s)

MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAA
NVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHGPA
ARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCPPHAPLARPSAVAEGPGLAQASGGSWRRCPG
ASSAGPPPWPRGYLRSAPGMGHPRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001164405
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001164405.1, NP_001157877
RefSeq ORF 708
Locus ID 727857
Cytogenetics 17p13.3
MW 24 kDa
Gene Summary This gene is a member of the basic helix-loop-helix family. The encoded protein is a transcription factor involved in limb development. Mutations in this gene have been associated with mesoaxial synostotic syndactyly Malik-Percin type (MSSD). Copy number variation of a locus containing this gene has been linked to a form of split-hand/foot malformation with long bone deficiency (SHFLD3). [provided by RefSeq, Mar 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)