Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Tagged ORF Clone

CAT#: RC228166

Reviews ()
Write a review

BHLHA9 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member a9 (BHLHA9)



  "NM_001164405" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BHLHA9
Synonyms BHLHF42; CCSPD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC228166 representing NM_001164405
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGGGGCGCGCCAGGACTAGGCCTCACGGCGCGGAAGGGGGCCGAGGACTCTGCGGAGGACTTGG
GGGGCCCCTGCCCCGAGCCCGGGGGCGATTCGGGGGTGCTGGGGGCGAACGGCGCTTCCTGCAGCCGGGG
CGAGGCGGAGGAGCCGGCGGGCAGGAGGCGCGCGCGGCCGGTGCGGTCCAAGGCGCGGCGCATGGCCGCC
AACGTGCGGGAGCGCAAGCGCATCCTAGACTACAACGAGGCCTTCAACGCGCTGCGCCGGGCGCTGCGGC
ACGACCTGGGCGGCAAGAGGCTCTCCAAGATCGCCACGCTGCGCAGGGCCATCCACCGCATCGCCGCGCT
CTCCCTGGTCCTGCGCGCCAGCCCCGCGCCCCGCGGGCCCTGCGGACACCTGGAGTGCCACGGCCCGGCC
GCGCGCGGGGACACCGGGGACACAGGCGCCAGCCCCCCGCCGCCTGCAGGGCCCAGCCTCGCGCGCCCAG
ACGCCGCCCGCCCCTCGGTGCCGTCCGCGCCCCGCTGCGCCTCGTGCCCCCCGCACGCGCCCCTGGCACG
GCCCAGTGCGGTGGCCGAGGGGCCGGGCCTAGCACAGGCCTCCGGGGGAAGCTGGCGCCGCTGTCCGGGG
GCTTCCTCTGCCGGGCCGCCTCCCTGGCCGCGGGGCTACCTGCGATCCGCCCCCGGGATGGGCCATCCGC
GCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228166 representing NM_001164405
Red=Cloning site Green=Tags(s)

MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAA
NVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHGPA
ARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCPPHAPLARPSAVAEGPGLAQASGGSWRRCPG
ASSAGPPPWPRGYLRSAPGMGHPRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001164405
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001164405.1, NP_001157877.1
RefSeq ORF 708 bp
Locus ID 727857
Cytogenetics 17p13.3
MW 24 kDa
Gene Summary This gene is a member of the basic helix-loop-helix family. The encoded protein is a transcription factor involved in limb development. Mutations in this gene have been associated with mesoaxial synostotic syndactyly Malik-Percin type (MSSD). Copy number variation of a locus containing this gene has been linked to a form of split-hand/foot malformation with long bone deficiency (SHFLD3). [provided by RefSeq, Mar 2015]

Citations (1)

Other Versions

Other products for "BHLHA9"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools