APLP2 (NM_001142276) Human Tagged ORF Clone

CAT#: RC226552

APLP2 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor-like protein 2 (APLP2), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name APLP2 (NM_001142276) Human Tagged ORF Clone
Symbol APLP2
Synonyms APLP-2; APPH; APPL2; CDEBP
Vector pCMV6-Entry
Sequence Data
>RC226552 representing NM_001142276
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCACCGGGACCGCGGCCGCCGCAGCCACGGGCAGGCTCCTGCTTCTGCTGCTGGTGGGGCTCA
CGGCGCCTGCCTTGGCGCTGGCCGGCTACATCGAGGCTCTTGCAGCCAATGCCGGAACAGGATTTGCTGT
TGCTGAGCCTCAAATCGCAATGTTTTGTGGGAAGTTAAATATGCATGTGAACATTCAGACTGGGAAATGG
GAACCTGATCCAACAGGCACCAAGAGCTGCTTTGAAACAAAAGAAGAAGTTCTTCAGTACTGTCAGGAGA
TGTATCCAGAGCTACAGATCACAAATGTGATGGAGGCAAACCAGCGGGTTAGTATTGACAACTGGTGCCG
GAGGGACAAAAAGCAATGCAAGAGTCGCTTTGTTACACCTTTCAAGTGTCTCGTGGGTGAATTTGTAAGT
GATGTCCTGCTAGTTCCAGAAAAGTGCCAGTTTTTCCACAAAGAGCGGATGGAGGTGTGTGAGAATCACC
AGCACTGGCACACGGTAGTCAAAGAGGCATGTCTGACTCAGGGAATGACCTTATATAGCTACGGCATGCT
GCTCCCATGTGGGGTAGACCAGTTCCATGGCACTGAATATGTGTGCTGCCCTCAGACAAAGATTATTGGA
TCTGTGTCAAAAGAAGAGGAAGAGGAAGATGAAGAGGAAGAGGAAGAGGAAGATGAAGAGGAAGACTATG
ATGTTTATAAAAGTGAATTTCCTACTGAAGCAGATCTGGAAGACTTCACAGAAGCAGCTGTGGATGAGGA
TGATGAGGATGAGGAAGAAGGGGAGGAAGTGGTGGAGGACCGAGATTACTACTATGACACCTTCAAAGGA
GATGACTACAATGAGGAGAATCCTACTGAACCCGGCAGCGACGGCACCATGTCAGACAAGGAAATTACTC
ATGATGTCAAAGCTGTCTGCTCCCAGGAGGCGATGACGGGGCCCTGCCGGGCCGTGATGCCTCGTTGGTA
CTTCGACCTCTCCAAGGGAAAGTGCGTGCGCTTTATATATGGTGGCTGCGGCGGCAACAGGAACAATTTT
GAGTCTGAGGATTATTGTATGGCTGTGTGTAAAGCGATGATTCCTCCAACTCCTCTGCCAACCAATGATG
TTGATGTGTATTTCGAGACCTCTGCAGATGATAATGAGCATGCTCGCTTCCAGAAGGCTAAGGAGCAGCT
GGAGATTCGGCACCGCAACCGAATGGACAGGGTAAAGAAGGAATGGGAAGAGGCAGAGCTTCAAGCTAAG
AACCTCCCCAAAGCAGAGAGGCAGACTCTGATTCAGCACTTCCAAGCCATGGTTAAAGCTTTAGAGAAGG
AAGCAGCCAGTGAGAAGCAGCAGCTGGTGGAGACCCACCTGGCCCGAGTGGAAGCTATGCTGAATGACCG
CCGTCGGATGGCTCTGGAGAACTACCTGGCTGCCTTGCAGTCTGACCCGCCACGGCCTCATCGCATTCTC
CAGGCCTTACGGCGTTATGTCCGTGCTGAGAACAAAGATCGCTTACATACCATCCGTCATTACCAGCATG
TGTTGGCTGTTGACCCAGAAAAGGCGGCCCAGATGAAATCCCAGGTGATGACACATCTCCACGTGATTGA
AGAAAGGAGGAACCAAAGCCTCTCTCTGCTCTACAAAGTACCTTATGTAGCCCAAGAAATTCAAGAGGAA
ATTGATGAGCTCCTTCAGGAGCAGCGTGCAGATATGGACCAGTTCACTGCCTCAATCTCAGAGACCCCTG
TGGACGTCCGGGTGAGCTCTGAGGAGAGTGAGGAGATCCCACCGTTCCACCCCTTCCACCCCTTCCCAGC
CCTACCTGAGAACGAAGGATCTGGAGTGGGAGAGCAGGATGGGGGACTGATCGGTGCCGAAGAGAAAGTG
ATTAACAGTAAGAATAAAGTGGATGAAAACATGGTCATTGACGAGACTCTGGATGTTAAGGAAATGATTT
TCAATGCCGAGAGAGTTGGAGGCCTCGAGGAAGAGCGGGAATCCGTGGGCCCACTGCGGGAGGACTTCAG
TCTGAGTAGCAGTGCTCTCATTGGCCTGCTGGTCATCGCAGTGGCCATTGCCACGGTCATCGTCATCAGC
CTGGTGATGCTGAGGAAGAGGCAGTATGGCACCATCAGCCACGGGATCGTGGAGGTTGATCCAATGCTCA
CCCCAGAAGAGCGTCACCTGAACAAGATGCAGAACCATGGCTATGAGAACCCCACCTACAAATACCTGGA
GCAGATGCAGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC226552 representing NM_001142276
Red=Cloning site Green=Tags(s)

MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKW
EPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVS
DVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIG
SVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKG
DDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNF
ESEDYCMAVCKAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAK
NLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQSDPPRPHRIL
QALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEE
IDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEGSGVGEQDGGLIGAEEKV
INSKNKVDENMVIDETLDVKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLVIAVAIATVIVIS
LVMLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001142276
ORF Size 2253 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001142276.1, NP_001135748
RefSeq ORF 2256
Locus ID 334
Cytogenetics 11q24.3
Protein Families Transmembrane, Druggable Genome
MW 85.3 kDa
Gene Summary This gene encodes amyloid precursor- like protein 2 (APLP2), which is a member of the APP (amyloid precursor protein) family including APP, APLP1 and APLP2. This protein is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. This protein interacts with major histocompatibility complex (MHC) class I molecules. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. This protein has been implicated in the pathogenesis of Alzheimer's disease. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)