CTNNA3 (NM_001127384) Human Tagged ORF Clone

CAT#: RC226241

CTNNA3 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 3 (CTNNA3), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 1,370.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CTNNA3 (NM_001127384) Human Tagged ORF Clone
Symbol CTNNA3
Synonyms ARVD13; VR22
Vector pCMV6-Entry
Sequence Data
>RC226241 representing NM_001127384
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCTGAAACACCAATCACATTGAATATCGATCCTCAGGATCTGCAGGTCCAAACATTCACCGTGG
AGAAGCTACTGGAGCCTCTCATAATCCAGGTTACCACACTTGTAAACTGTCCCCAGAACCCTTCCAGCAG
GAAAAAAGGACGTTCGAAAAGAGCCAGTGTCCTTCTAGCTTCTGTGGAGGAAGCAACTTGGAATTTATTA
GACAAGGGAGAGAAGATTGCCCAGGAAGCTACAGTTTTAAAGGATGAGCTTACGGCTTCACTTGAGGAAG
TTCGCAAAGAAAGTGAAGCTCTGAAAGTATCAGCTGAGAGATTTACAGATGACCCCTGTTTTCTCCCAAA
AAGGGAGGCTGTGGTTCAAGCTGCCCGTGCCTTGCTGGCTGCGGTGACGAGACTCCTTATCCTTGCGGAC
ATGATTGATGTCATGTGCCTCTTGCAACATGTGTCAGCTTTTCAAAGGACATTTGAGTCTCTCAAAAATG
TTGCCAACAAATCTGACCTCCAGAAAACCTACCAGAAGCTTGGGAAGGAGCTGGAAAATTTGGATTATTT
AGCCTTCAAACGTCAGCAGGACTTAAAATCTCCAAATCAGAGAGATGAAATTGCAGGAGCCCGAGCTTCA
CTGAAGGAGAACTCTCCCCTCTTGCATTCAATTTGTTCAGCTTGTTTGGAGCATTCTGATGTTGCTTCCC
TCAAAGCAAGCAAGGACACAGTTTGTGAAGAAATTCAGAATGCTCTCAATGTAATTTCAAATGCTTCACA
AGGGATCCAGAATATGACAACCCCACCAGAACCTCAGGCAGCAACCCTGGGAAGTGCCCTTGATGAGCTG
GAGAATTTAATTGTCCTGAATCCACTCACAGTAACTGAGGAGGAAATACGACCATCACTAGAGAAACGCC
TTGAAGCCATTATCAGTGGGGCTGCTCTGCTGGCGGATTCTTCATGTACGAGGGACTTACACCGAGAGCG
GATTATCGCAGAATGCAACGCCATTCGCCAGGCTCTTCAGGATCTGCTTTCAGAGTACATGAACAACGCT
GGAAAAAAAGAAAGGAGTAATACCCTGAATATTGCTTTAGACAACATGTGTAAGAAGACAAGAGACCTTC
GCAGACAGCTCCGCAAGGCTATTATAGATCATGTGTCAGACTCTTTCCTGGATACGACAGTCCCTCTTTT
GGTTCTCATTGAAGCTGCTAAGAATGGCCGGGAAAAGGAAATAAAAGAATATGCTGCGATATTTCATGAA
CACACCAGCAGGCTTGTAGAGGTGGCAAATCTTGCTTGTTCCATGTCAACAAATGAAGATGGAATTAAAA
TTGTCAAAATTGCAGCCAATCATTTGGAAACCTTGTGTCCACAGATTATTAATGCTGCACTTGCTTTGGC
TGCAAGACCCAAAAGTCAAGCGGTCAAAAACACCATGGAAATGTACAAGCGTACATGGGAGAATCATATA
CATGTCCTCACTGAAGCCGTAGATGACATTACAAGCATTGATGACTTCCTTGCTGTATCTGAAAGCCATA
TCTTGGAAGATGTCAACAAGTGTATCATAGCCTTAAGAGACCAGGATGCTGATAATTTAGACCGTGCTGC
GGGTGCTATCAGAGGCCGGGCAGCAAGAGTTGCTCACATCGTCACGGGTGAAATGGACAGTTACGAGCCA
GGGGCTTACACGGAAGGTGTAATGAGAAATGTTAACTTCCTTACAAGTACTGTAATTCCTGAATTTGTAA
CACAAGTGAATGTTGCCTTGGAAGCCTTAAGCAAAAGCTCATTGAATGTGTTGGATGATAATCAATTTGT
GGACATCTCAAAGAAGATCTATGATACAATTCATGATATCAGATGTTCAGTCATGATGATTCGGACCCCA
GAGGAACTGGAGGATGTTTCTGACCTTGAAGAGGAACACGAGGTCCGCAGTCACACCAGCATTCAGACCG
AAGGGAAAACTGATAGGGCTAAGATGACTCAACTGCCTGAGGCAGAAAAAGAAAAGATTGCTGAGCAAGT
TGCTGATTTCAAGAAAGTAAAGAGTAAGCTGGATGCTGAGATTGAGATATGGGATGATACAAGCAACGAC
ATCATTGTTCTGGCCAAGAACATGTGTATGATCATGATGGAGATGACAGACTTCACTAGGGGCAAAGGAC
CACTAAAGCATACAACTGATGTGATCTATGCAGCGAAAATGATATCAGAATCAGGATCAAGGATGGATGT
CCTTGCTCGGCAGATTGCTAATCAGTGCCCAGATCCATCTTGTAAACAGGACTTGTTGGCCTACCTGGAA
CAGATTAAGTTCTACTCCCACCAACTGAAAATCTGCAGTCAAGTTAAAGCTGAGATCCAGAACCTGGGAG
GAGAGCTCATCATGTCAGCTTTGGACAGTGTCACATCCCTGATCCAAGCAGCCAAAAATTTAATGAATGC
TGTAGTGCAAACAGTGAAAATGTCTTACATTGCCTCAACCAAGATCATCCGAATCCAGAGTCCTGCTGGG
CCCCGGCACCCAGTTGTGATGTGGAGAATGAAGGCTCCTGCAAAAAAACCCTTGATTAAAAGAGAGAAGC
CAGAGGAAACGTGTGCAGCTGTCAGACGAGGCTCAGCAAAGAAAAAAATCCATCCATTGCAAGTCATGAG
TGAATTTAGAGGAAGACAAATCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC226241 representing NM_001127384
Red=Cloning site Green=Tags(s)

MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLL
DKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREAVVQAARALLAAVTRLLILAD
MIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARAS
LKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDEL
ENLIVLNPLTVTEEEIRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNA
GKKERSNTLNIALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTMEMYKRTWENHI
HVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEP
GAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTP
EELEDVSDLEEEHEVRSHTSIQTEGKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSND
IIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLE
QIKFYSHQLKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001127384
ORF Size 2685 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001127384.1, NM_001127384.2, NP_001120856
RefSeq ORF 2688
Locus ID 29119
Cytogenetics 10q21.3
Protein Pathways Adherens junction, Tight junction, Leukocyte transendothelial migration, Pathways in cancer, Endometrial cancer, Arrhythmogenic right ventricular cardiomyopathy (ARVC)
MW 99.6 kDa
Gene Summary This gene encodes a protein that belongs to the vinculin/alpha-catenin family. The encoded protein plays a role in cell-cell adhesion in muscle cells. Mutations in this gene are associated with arrhythmogenic right ventricular dysplasia, familial 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)