SUN1 (NM_001130965) Human Tagged ORF Clone

CAT#: RC226167

Reviews ()
Write a review

SUN1 (Myc-DDK-tagged)-Human Sad1 and UNC84 domain containing 1 (SUN1), transcript variant 1



Reconstitution Protocol

USD 719.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SUN1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SUN1
Synonyms UNC84A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC226167 representing NM_001130965
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTTTCTCGGCTTCACATGTACAGTCCTCCCCAGTGTGTGCCGGAGAACACGGGCTACACGTATG
CGCTCAGTTCCAGCTATTCTTCAGATGCTCTGGATTTTGAGACGGAGCACAAATTGGACCCTGTATTTGA
TTCTCCACGGATGTCCCGCCGTAGTTTGCGCCTGGCCACGACAGCATGCACCCTGGGGGATGGTGAGGCT
GTGGGTGCCGACAGCGGCACCAGCAGCGCTGTCTCCCTGAAGAACCGAGCGGCCAGAACAACAAAACAGC
GCAGAAGCACAAACAAATCAGCTTTTAGTATCAACCACGTGTCAAGGCAGGTCACGTCCTCTGGCGTCAG
CCACGGCGGCACTGTCAGCCTGCAGGATGCTGTGACTCGACGGCCTCCTGTATTGGACGAGTCTTGGATT
CGTGAACAGACCACAGTGGACCACTTCTGGGGTCTTGATGATGATGGTGATCTTAAAGGTGGAAATAAAG
CTGCCATTCAGGGAAACGGGGATGTGGGAGCCGCCGCCGCCACCGCGCACAACGGCTTCTCCTGCAGCAA
CTGCAGCATGCTGTCCGAGCGCAAGGACGTGCTCACGGCGCACCCCGCGGCCCCCGGGCCCGTGTCGAGA
GTTTATTCTAGGGACAGGAATCAAAAATGTTACTTCTTGCTGCAGATTCTGCGCAGGATCGGAGCTGTGG
GCCAGGCTGTGTCCAGGACGGCGTGGTCGGCCCTTTGGCTGGCCGTGGTTGCTCCAGGGAAGGCAGCCTC
TGGAGTGTTCTGGTGGCTGGGGATTGGATGGTACCAGTTTGTTACTTTGATTTCTTGGCTGAATGTGTTT
CTTCTTACCAGGTGCCTTCGAAACATCTGCAAGTTTTTAGTCTTGCTCATCCCACTCTTCCTTTTACTAG
CAGGTCTCTCCTTACGGGGCCAGGGCAATTTCTTTTCGTTCTTGCCCGTGTTGAACTGGGCAAGCATGCA
TAGAACACAGCGGGTGGATGACCCCCAGGACGTGTTTAAACCCACGACTTCTCGCCTGAAGCAGCCTCTG
CAGGGTGACAGTGAGGCTTTTCCGTGGCATTGGATGAGTGGCGTGGAGCAGCAGGTGGCCTCTCTGTCTG
GACAGTGCCACCACCATGGTGAGAATCTCCGAGAGCTGACCACTTTGCTACAGAAGCTGCAGGCTCGGGT
GGACCAGATGGAAGGCGGCGCTGCCGGGCCGTCAGCTTCGGTCAGAGACGCTGTGGGACAGCCCCCGAGG
GAGACTGACTTTATGGCCTTTCACCAAGAACATGAAGTGCGTATGTCACACTTGGAAGATATTCTGGGAA
AACTGAGAGAAAAATCTGAGGCCATCCAGAAGGAACTAGAACAGACCAAGCAAAAAACAATCAGTGCGGT
TGGTGAGCAGCTCCTGCCCACAGTCGAGCACCTCCAGCTGGAGCTGGATCAGCTAAAGTCAGAGCTGTCC
AGCTGGCGACACGTGAAGACCGGCTGTGAGACAGTGGATGCCGTACAAGAAAGAGTGGACGTGCAAGTCA
GAGAAATGGTGAAACTCCTGTTTTCCGAAGATCAGCAAGGCGGTTCTCTGGAACAGCTGCTGCAGAGGTT
CTCATCACAGTTTGTGAGCAAAGGCGACTTGCAGACGATGCTGCGAGACCTGCAGCTGCAGATCCTGCGG
AACGTCACCCACCACGTTTCCGTGACCAAGCAGCTCCCAACCTCAGAAGCCGTGGTGTCTGCTGTGAGCG
AGGCGGGGGCGTCTGGAATAACAGAGGCGCAAGCACGTGCCATCGTGAACAGCGCCTTGAAGCTGTATTC
CCAAGATAAGACCGGGATGGTGGACTTTGCTCTGGAATCTGGTGGTGGCAGCATCTTGAGTACTCGCTGT
TCTGAAACTTACGAAACCAAAACGGCGCTGATGAGTCTGTTTGGGATCCCGCTGTGGTACTTCTCGCAGT
CCCCGCGCGTGGTCATCCAGCCTGACATTTACCCCGGTAACTGCTGGGCATTTAAAGGCTCCCAGGGGTA
CCTGGTGGTGAGGCTCTCCATGATGATCCACCCAGCCGCCTTCACTCTGGAGCACATCCCTAAGACGCTG
TCGCCAACAGGCAACATCAGCAGCGCCCCCAAGGACTTCGCCGTCTATGGATTAGAAAATGAGTATCAGG
AAGAAGGGCAGCTTCTGGGACAGTTCACGTATGATCAGGATGGGGAGTCGCTCCAGATGTTCCAGGCCCT
GAAAAGACCCGACGACACAGCTTTCCAAATAGTGGAACTTCGGATTTTTTCTAACTGGGGCCATCCTGAG
TATACCTGTCTGTATCGGTTCAGAGTTCATGGCGAACCTGTCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC226167 representing NM_001130965
Red=Cloning site Green=Tags(s)

MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEA
VGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWI
REQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSR
VYSRDRNQKCYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNVF
LLTRCLRNICKFLVLLIPLFLLLAGLSLRGQGNFFSFLPVLNWASMHRTQRVDDPQDVFKPTTSRLKQPL
QGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELTTLLQKLQARVDQMEGGAAGPSASVRDAVGQPPR
ETDFMAFHQEHEVRMSHLEDILGKLREKSEAIQKELEQTKQKTISAVGEQLLPTVEHLQLELDQLKSELS
SWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILR
NVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRC
SETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTL
SPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPE
YTCLYRFRVHGEPVK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001130965
ORF Size 2355 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001130965.3
RefSeq ORF 2358 bp
Locus ID 23353
UniProt ID O94901
Cytogenetics 7p22.3
Protein Families Transmembrane
MW 86.9 kDa
Gene Summary This gene is a member of the unc-84 homolog family and encodes a nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2019]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.