Cortactin(CTTN) (NM_005231) Human Tagged ORF Clone

CAT#: RC223259

CTTN (Myc-DDK-tagged)-Human cortactin (CTTN), transcript variant 1

Clone Modification / Custom Cloning Service

USD 701.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cortactin(CTTN) (NM_005231) Human Tagged ORF Clone
Symbol CTTN
Synonyms EMS1; EMS1
Vector pCMV6-Entry
Sequence Data
>RC223259 representing NM_005231
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAAAGCTTCAGCAGGCCACGCTGTGTCCATCGCCCAGGATGACGCGGGGGCCGATGACTGGGAGA
CCGACCCTGATTTTGTGAATGATGTGAGTGAGAAGGAGCAAAGATGGGGTGCCAAGACGGTGCAGGGCTC
CGGGCACCAGGAGCATATCAACATACACAAGCTGAGGGAGAATGTCTTTCAAGAGCATCAGACCCTTAAG
GAGAAGGAACTTGAAACAGGACCAAAAGCTTCCCATGGCTATGGAGGGAAATTTGGTGTGGAACAAGACC
GAATGGATAAGTCAGCTGTCGGCCACGAATATCAGTCGAAACTTTCCAAGCACTGCTCGCAGGTGGACTC
GGTCCGTGGCTTCGGAGGCAAGTTTGGTGTCCAGATGGACAGAGTTGATCAGTCTGCTGTAGGCTTTGAA
TACCAGGGGAAGACTGAGAAGCATGCCTCCCAGAAAGACTACTCCAGTGGTTTTGGCGGCAAGTATGGCG
TGCAGGCCGACCGAGTAGACAAGAGCGCGGTGGGCTTCGACTACCAGGGCAAGACGGAGAAGCACGAGTC
ACAGAGAGATTACTCCAAAGGTTTCGGCGGCAAATACGGTATCGACAAGGACAAAGTGGATAAGAGCGCC
GTTGGCTTTGAGTATCAAGGCAAAACGGAGAAGCACGAGTCCCAGAAAGACTATGTGAAAGGGTTTGGAG
GAAAATTTGGTGTGCAGACAGACAGACAAGACAAATGTGCCCTTGGCTGGGATCACCAGGAGAAATTGCA
GCTGCATGAATCCCAAAAAGATTATAAGACTGGTTTTGGAGGCAAATTCGGTGTTCAGTCGGAGAGGCAG
GACTCCGCTGCTGTGGGGTTTGATTACAAGGAGAAGCTGGCCAAGCACGAGTCCCAGCAAGACTACTCCA
AAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGT
CACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATC
AGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAG
CCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGC
CAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTC
TATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGC
CCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAG
AACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTG
ACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCG
GTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223259 representing NM_005231
Red=Cloning site Green=Tags(s)

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK
EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE
YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA
VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQ
DSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNI
RANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPV
YEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYE
NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005231
ORF Size 1650 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005231.1, NM_005231.2, NM_005231.3, NP_005222
RefSeq Size 3243
RefSeq ORF 1653
Locus ID 2017
Cytogenetics 11q13.3
Domains SH3, HS1_rep
Protein Families Druggable Genome
Protein Pathways Tight junction, Pathogenic Escherichia coli infection
MW 61.4 kDa
Gene Summary This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (4)