Cortactin (CTTN) (NM_005231) Human Tagged ORF Clone

CAT#: RG223259

Reviews ()
Write a review
  • TrueORF®

CTTN (GFP-tagged) - Human cortactin (CTTN), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 968.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CTTN
Synonyms EMS1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG223259 representing NM_005231
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAAAGCTTCAGCAGGCCACGCTGTGTCCATCGCCCAGGATGACGCGGGGGCCGATGACTGGGAGA
CCGACCCTGATTTTGTGAATGATGTGAGTGAGAAGGAGCAAAGATGGGGTGCCAAGACGGTGCAGGGCTC
CGGGCACCAGGAGCATATCAACATACACAAGCTGAGGGAGAATGTCTTTCAAGAGCATCAGACCCTTAAG
GAGAAGGAACTTGAAACAGGACCAAAAGCTTCCCATGGCTATGGAGGGAAATTTGGTGTGGAACAAGACC
GAATGGATAAGTCAGCTGTCGGCCACGAATATCAGTCGAAACTTTCCAAGCACTGCTCGCAGGTGGACTC
GGTCCGTGGCTTCGGAGGCAAGTTTGGTGTCCAGATGGACAGAGTTGATCAGTCTGCTGTAGGCTTTGAA
TACCAGGGGAAGACTGAGAAGCATGCCTCCCAGAAAGACTACTCCAGTGGTTTTGGCGGCAAGTATGGCG
TGCAGGCCGACCGAGTAGACAAGAGCGCGGTGGGCTTCGACTACCAGGGCAAGACGGAGAAGCACGAGTC
ACAGAGAGATTACTCCAAAGGTTTCGGCGGCAAATACGGTATCGACAAGGACAAAGTGGATAAGAGCGCC
GTTGGCTTTGAGTATCAAGGCAAAACGGAGAAGCACGAGTCCCAGAAAGACTATGTGAAAGGGTTTGGAG
GAAAATTTGGTGTGCAGACAGACAGACAAGACAAATGTGCCCTTGGCTGGGATCACCAGGAGAAATTGCA
GCTGCATGAATCCCAAAAAGATTATAAGACTGGTTTTGGAGGCAAATTCGGTGTTCAGTCGGAGAGGCAG
GACTCCGCTGCTGTGGGGTTTGATTACAAGGAGAAGCTGGCCAAGCACGAGTCCCAGCAAGACTACTCCA
AAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGT
CACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATC
AGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAG
CCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGC
CAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTC
TATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGC
CCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTATGATGAGTACGAG
AACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTG
ACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCG
GTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG223259 representing NM_005231
Red=Cloning site Green=Tags(s)

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK
EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE
YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA
VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQ
DSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNI
RANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPV
YEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYE
NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005231
ORF Size 1650 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005231.2, NP_005222.2
RefSeq Size 3243 bp
RefSeq ORF 1653 bp
Locus ID 2017
UniProt ID Q14247
Cytogenetics 11q13.3
Domains SH3, HS1_rep
Protein Families Druggable Genome
Protein Pathways Pathogenic Escherichia coli infection, Tight junction
Gene Summary This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010]
Other products for "CTTN"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.