DNMT3B (NM_006892) Human Tagged ORF Clone

CAT#: RC223206

DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1

Change vector?

USD 1,309


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DNMT3B (NM_006892) Human Tagged ORF Clone
Symbol DNMT3B
Synonyms ICF; ICF1; M.HsaIIIB
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC223206 representing NM_006892
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCA
ACGGGGCCTGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAG
AGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTG
ACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTCTTCCGGGAAA
CCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCA
CAGGCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTC
CCGGCTACCAGGTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCT
CTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCC
CTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGA
GATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCA
AGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGG
CATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTCTCTGCAGACAAACTGGTGGCACTG
GGGCTGTTCAGCCAGCACTTTAATTTGGCCACCTTCAATAAGCTCGTCTCCTATCGAAAAGCCATGTACC
ATGCTCTGGAGAAAGCTAGGGTGCGAGCTGGCAAGACCTTCCCCAGCAGCCCTGGAGACTCATTGGAGGA
CCAGCTGAAGCCCATGTTGGAGTGGGCCCACGGGGGCTTCAAGCCCACTGGGATCGAGGGCCTCAAACCC
AACAACACGCAACCAGTGGTTAATAAGTCGAAGGTGCGTCGTGCAGGCAGTAGGAAATTAGAATCAAGGA
AATACGAGAACAAGACTCGAAGACGCACAGCTGACGACTCAGCCACCTCTGACTACTGCCCCGCACCCAA
GCGCCTCAAGACAAATTGCTATAACAACGGCAAAGACCGAGGGGATGAAGATCAGAGCCGAGAACAAATG
GCTTCAGATGTTGCCAACAACAAGAGCAGCCTGGAAGATGGCTGTTTGTCTTGTGGCAGGAAAAACCCCG
TGTCCTTCCACCCTCTCTTTGAGGGGGGGCTCTGTCAGACATGCCGGGATCGCTTCCTTGAGCTGTTTTA
CATGTATGATGACGATGGCTATCAGTCTTACTGCACTGTGTGCTGCGAGGGCCGAGAGCTGCTGCTTTGC
AGCAACACGAGCTGCTGCCGGTGTTTCTGTGTGGAGTGCCTGGAGGTGCTGGTGGGCACAGGCACAGCGG
CCGAGGCCAAGCTTCAGGAGCCCTGGAGCTGTTACATGTGTCTCCCGCAGCGCTGTCATGGCGTCCTGCG
GCGCCGGAAGGACTGGAACGTGCGCCTGCAGGCCTTCTTCACCAGTGACACGGGGCTTGAATATGAAGCC
CCCAAGCTGTACCCTGCCATTCCCGCAGCCCGAAGGCGGCCCATTCGAGTCCTGTCATTGTTTGATGGCA
TCGCGACAGGCTACCTAGTCCTCAAAGAGTTGGGCATAAAGGTAGGAAAGTACGTCGCTTCTGAAGTGTG
TGAGGAGTCCATTGCTGTTGGAACCGTGAAGCACGAGGGGAATATCAAATACGTGAACGACGTGAGGAAC
ATCACAAAGAAAAATATTGAAGAATGGGGCCCATTTGACTTGGTGATTGGCGGAAGCCCATGCAACGATC
TCTCAAATGTGAATCCAGCCAGGAAAGGCCTGTATGAGGGTACAGGCCGGCTCTTCTTCGAATTTTACCA
CCTGCTGAATTACTCACGCCCCAAGGAGGGTGATGACCGGCCGTTCTTCTGGATGTTTGAGAATGTTGTA
GCCATGAAGGTTGGCGACAAGAGGGACATCTCACGGTTCCTGGAGTGTAATCCAGTGATGATTGATGCCA
TCAAAGTTTCTGCTGCTCACAGGGCCCGATACTTCTGGGGCAACCTACCCGGGATGAACAGGCCCGTGAT
AGCATCAAAGAATGATAAACTCGAGCTGCAGGACTGCTTGGAATACAATAGGATAGCCAAGTTAAAGAAA
GTACAGACAATAACCACCAAGTCGAACTCGATCAAACAGGGGAAAAACCAACTTTTCCCTGTTGTCATGA
ATGGCAAAGAAGATGTTTTGTGGTGCACTGAGCTCGAAAGGATCTTTGGCTTTCCTGTGCACTACACAGA
CGTGTCCAACATGGGCCGTGGTGCCCGCCAGAAGCTGCTGGGAAGGTCCTGGAGCGTGCCTGTCATCCGA
CACCTCTTCGCCCCTCTGAAGGACTACTTTGCATGTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223206 representing NM_006892
Red=Cloning site Green=Tags(s)

MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL
TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF
PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG
DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL
GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP
NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC
SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA
PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN
ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV
AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK
VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR
HLFAPLKDYFACE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006892
ORF Size 2559 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006892.1, NM_006892.2, NM_006892.3, NP_008823
RefSeq Size 4353
RefSeq ORF 2562
Locus ID 1789
Cytogenetics 20q11.21
Domains PWWP, DNA_methylase
Protein Families Stem cell - Pluripotency, Embryonic stem cells, Induced pluripotent stem cells, Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
MW 95.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations