DNMT3B (NM_006892) Human Tagged ORF Clone

CAT#: RC223206

Reviews ()
Write a review

DNMT3B (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B), transcript variant 1



  "NM_006892" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 851.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DNMT3B
Synonyms ICF; ICF1; M.HsaIIIB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223206 representing NM_006892
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCA
ACGGGGCCTGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAG
AGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTG
ACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTCTTCCGGGAAA
CCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCA
CAGGCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTC
CCGGCTACCAGGTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCT
CTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCC
CTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGA
GATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCA
AGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGG
CATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTCTCTGCAGACAAACTGGTGGCACTG
GGGCTGTTCAGCCAGCACTTTAATTTGGCCACCTTCAATAAGCTCGTCTCCTATCGAAAAGCCATGTACC
ATGCTCTGGAGAAAGCTAGGGTGCGAGCTGGCAAGACCTTCCCCAGCAGCCCTGGAGACTCATTGGAGGA
CCAGCTGAAGCCCATGTTGGAGTGGGCCCACGGGGGCTTCAAGCCCACTGGGATCGAGGGCCTCAAACCC
AACAACACGCAACCAGTGGTTAATAAGTCGAAGGTGCGTCGTGCAGGCAGTAGGAAATTAGAATCAAGGA
AATACGAGAACAAGACTCGAAGACGCACAGCTGACGACTCAGCCACCTCTGACTACTGCCCCGCACCCAA
GCGCCTCAAGACAAATTGCTATAACAACGGCAAAGACCGAGGGGATGAAGATCAGAGCCGAGAACAAATG
GCTTCAGATGTTGCCAACAACAAGAGCAGCCTGGAAGATGGCTGTTTGTCTTGTGGCAGGAAAAACCCCG
TGTCCTTCCACCCTCTCTTTGAGGGGGGGCTCTGTCAGACATGCCGGGATCGCTTCCTTGAGCTGTTTTA
CATGTATGATGACGATGGCTATCAGTCTTACTGCACTGTGTGCTGCGAGGGCCGAGAGCTGCTGCTTTGC
AGCAACACGAGCTGCTGCCGGTGTTTCTGTGTGGAGTGCCTGGAGGTGCTGGTGGGCACAGGCACAGCGG
CCGAGGCCAAGCTTCAGGAGCCCTGGAGCTGTTACATGTGTCTCCCGCAGCGCTGTCATGGCGTCCTGCG
GCGCCGGAAGGACTGGAACGTGCGCCTGCAGGCCTTCTTCACCAGTGACACGGGGCTTGAATATGAAGCC
CCCAAGCTGTACCCTGCCATTCCCGCAGCCCGAAGGCGGCCCATTCGAGTCCTGTCATTGTTTGATGGCA
TCGCGACAGGCTACCTAGTCCTCAAAGAGTTGGGCATAAAGGTAGGAAAGTACGTCGCTTCTGAAGTGTG
TGAGGAGTCCATTGCTGTTGGAACCGTGAAGCACGAGGGGAATATCAAATACGTGAACGACGTGAGGAAC
ATCACAAAGAAAAATATTGAAGAATGGGGCCCATTTGACTTGGTGATTGGCGGAAGCCCATGCAACGATC
TCTCAAATGTGAATCCAGCCAGGAAAGGCCTGTATGAGGGTACAGGCCGGCTCTTCTTCGAATTTTACCA
CCTGCTGAATTACTCACGCCCCAAGGAGGGTGATGACCGGCCGTTCTTCTGGATGTTTGAGAATGTTGTA
GCCATGAAGGTTGGCGACAAGAGGGACATCTCACGGTTCCTGGAGTGTAATCCAGTGATGATTGATGCCA
TCAAAGTTTCTGCTGCTCACAGGGCCCGATACTTCTGGGGCAACCTACCCGGGATGAACAGGCCCGTGAT
AGCATCAAAGAATGATAAACTCGAGCTGCAGGACTGCTTGGAATACAATAGGATAGCCAAGTTAAAGAAA
GTACAGACAATAACCACCAAGTCGAACTCGATCAAACAGGGGAAAAACCAACTTTTCCCTGTTGTCATGA
ATGGCAAAGAAGATGTTTTGTGGTGCACTGAGCTCGAAAGGATCTTTGGCTTTCCTGTGCACTACACAGA
CGTGTCCAACATGGGCCGTGGTGCCCGCCAGAAGCTGCTGGGAAGGTCCTGGAGCGTGCCTGTCATCCGA
CACCTCTTCGCCCCTCTGAAGGACTACTTTGCATGTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223206 representing NM_006892
Red=Cloning site Green=Tags(s)

MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL
TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF
PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG
DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL
GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP
NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC
SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA
PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN
ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV
AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK
VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR
HLFAPLKDYFACE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006892
ORF Size 2559 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006892.4
RefSeq Size 4353 bp
RefSeq ORF 2562 bp
Locus ID 1789
UniProt ID Q9UBC3
Cytogenetics 20q11.21
Domains PWWP, DNA_methylase
Protein Families Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
MW 95.8 kDa
Gene Summary CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. [provided by RefSeq, May 2011]

Other Versions

Other products for "DNMT3B"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit polyclonal anti-DNMT3B antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.