NEDD4 (NM_006154) Human Tagged ORF Clone

CAT#: RC221706

Reviews ()
Write a review

NEDD4 (Myc-DDK-tagged)-Human neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 824.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NEDD4
Synonyms NEDD4-1; RPF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221706 representing NM_006154
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAACTTGCGCGGTGGAGGTGTTCGGGCTCCTGGAGGACGAGGAAAATTCACGAATTGTGAGAGTAA
GAGTTATAGCCGGAATAGGCCTTGCCAAGAAGGATATATTGGGAGCTAGTGATCCTTACGTGAGAGTGAC
GTTATATGACCCAATGAATGGAGTTCTTACAAGTGTGCAAACAAAAACCATTAAAAAGAGTTTGAATCCA
AAGTGGAATGAAGAAATATTATTCAGAGTTCATCCTCAGCAGCACCGGCTTCTTTTTGAAGTGTTTGACG
AAAACCGATTGACAAGAGATGATTTCCTAGGTCAAGTGGATGTTCCACTTTATCCATTACCGACAGAAAA
TCCAAGATTGGAGAGACCATATACATTTAAGGATTTTGTTCTTCATCCAAGAAGTCACAAATCAAGAGTT
AAAGGTTATCTGAGACTAAAAATGACTTATTTACCTAAAACCAGTGGCTCAGAAGATGATAATGCAGAAC
AGGCTGAGGAATTAGAGCCTGGCTGGGTTGTTTTGGACCAACCAGATGCTGCTTGCCATTTGCAGCAACA
ACAAGAACCTTCTCCTCTACCTCCAGGGTGGGAAGAGAGGCAGGATATCCTTGGAAGGACCTATTATGTA
AACCATGAATCTAGAAGAACACAGTGGAAAAGACCAACCCCTCAGGACAACCTAACAGATGCTGAGAATG
GCAACATTCAACTGCAAGCACAACGTGCATTTACCACCAGGCGGCAGATATCCGAGGAAACAGAAAGTGT
TGACAACCAAGAGTCTTCCGAGAACTGGGAAATTATAAGAGAAGATGAAGCCACCATGTATAGCAGCCAG
GCCTTCCCATCACCTCCACCGTCAAGTAACTTGGATGTTCCAACTCATCTTGCAGAAGAATTGAATGCCA
GACTCACCATTTTTGGAAATTCAGCCGTGAGCCAGCCAGCATCGAGCTCAAATCATTCCAGCAGAAGAGG
CAGCTTACAAGCCTATACTTTTGAGGAACAACCTACACTTCCTGTGCTTTTGCCTACTTCATCTGGATTA
CCACCAGGTTGGGAAGAAAAACAAGATGAAAGAGGAAGATCATATTATGTAGATCACAATTCCAGAACGA
CTACTTGGACAAAGCCCACTGTACAGGCCACAGTGGAGACCAGTCAGCTGACCTCAAGCCAGAGTTCTGC
AGGCCCTCAATCACAAGCCTCCACCAGTGATTCAGGCCAGCAGGTGACCCAGCCATCTGAAATTGAGCAA
GGATTCCTTCCTAAAGGCTGGGAAGTCCGGCATGCACCAAATGGGAGGCCTTTCTTTATTGACCACAACA
CTAAAACCACCACCTGGGAAGATCCAAGATTGAAAATTCCAGCCCATCTGAGAGGAAAGACATCACTTGA
TACTTCCAATGATCTAGGGCCTTTACCTCCAGGATGGGAAGAGAGAACTCACACAGATGGAAGAATCTTC
TACATAAATCACAATATAAAAAGAACACAATGGGAAGATCCTCGGTTGGAGAATGTAGCAATAACTGGAC
CAGCAGTGCCCTACTCCAGGGATTACAAAAGAAAGTATGAGTTCTTCCGAAGAAAGTTGAAGAAGCAGAA
TGACATTCCAAACAAATTTGAAATGAAACTTCGCCGAGCAACTGTTCTTGAAGACTCTTACCGGAGAATT
ATGGGTGTCAAGAGAGCAGACTTCCTGAAGGCTCGACTGTGGATTGAGTTTGATGGTGAAAAGGGATTGG
ATTATGGAGGAGTTGCCAGAGAATGGTTCTTCCTGATCTCAAAGGAAATGTTTAACCCTTATTATGGGTT
GTTTGAATATTCTGCTACGGACAATTATACCCTACAGATAAATCCAAACTCTGGATTGTGTAACGAAGAT
CACCTCTCTTACTTCAAGTTTATTGGTCGGGTAGCTGGAATGGCAGTTTATCATGGCAAACTGTTGGATG
GTTTTTTCATCCGCCCATTTTACAAGATGATGCTTCACAAACCAATAACCCTTCATGATATGGAATCTGT
GGATAGTGAATATTACAATTCCCTAAGATGGATTCTTGAAAATGACCCAACAGAATTGGACCTCAGGTTT
ATCATAGATGAAGAACTTTTTGGACAGACACATCAACATGAGCTGAAAAATGGTGGATCAGAAATAGTTG
TCACCAATAAGAACAAAAAGGAATATATTTATCTTGTAATACAATGGCGATTTGTAAACCGAATCCAGAA
GCAAATGGCTGCTTTTAAAGAGGGATTCTTTGAACTAATACCACAGGATCTCATCAAAATTTTTGATGAA
AATGAACTAGAGCTTCTTATGTGTGGACTGGGAGATGTTGATGTGAATGACTGGAGGGAACATACAAAGT
ATAAAAATGGCTACAGTGCAAATCATCAGGTTATACAGTGGTTTTGGAAGGCTGTTTTAATGATGGATTC
AGAAAAAAGAATAAGATTACTTCAGTTTGTCACTGGCACATCTCGGGTGCCTATGAATGGATTTGCTGAA
CTATACGGTTCAAATGGACCACAGTCATTTACAGTTGAACAGTGGGGTACGCCTGAAAAGCTGCCAAGAG
CTCATACCTGTTTTAATCGCCTGGACTTGCCACCTTATGAATCATTTGAAGAATTATGGGATAAACTTCA
GATGGCAATTGAAAACACCCAGGGCTTTGATGGAGTTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221706 representing NM_006154
Red=Cloning site Green=Tags(s)

MATCAVEVFGLLEDEENSRIVRVRVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNP
KWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRV
KGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYV
NHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETESVDNQESSENWEIIREDEATMYSSQ
AFPSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGL
PPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEERTHTDGRIF
YINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRI
MGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNED
HLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRF
IIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDE
NELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006154
ORF Size 2700 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006154.1, NP_006145.1
RefSeq Size 5749 bp
RefSeq ORF 2703 bp
Locus ID 4734
UniProt ID P46934
Cytogenetics 15q21.3
Protein Families Druggable Genome
Protein Pathways Endocytosis, Ubiquitin mediated proteolysis
MW 104 kDa
Gene Summary This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN. [provided by RefSeq, Jul 2016]
Other products for "NEDD4"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.