Fibulin 1 (FBLN1) (NM_006486) Human Tagged ORF Clone

CAT#: RC221597

Reviews ()
Write a review

FBLN1 (Myc-DDK-tagged)-Human fibulin 1 (FBLN1), transcript variant D



  "NM_006486" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FBLN1
Synonyms FBLN; FIBL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221597 representing NM_006486
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGCGCCGCGCCGTCGCGCCGGGTCCCGCTTCCGCTGCTGCTGCTCGGCGGCCTTGCGCTGCTGG
CGGCCGGAGTGGACGCGGATGTCCTCCTGGAGGCCTGCTGTGCGGACGGACACCGGATGGCCACTCATCA
GAAGGACTGCTCGCTGCCATATGCTACGGAATCCAAAGAATGCAGGATGGTGCAGGAGCAGTGCTGCCAC
AGCCAGCTGGAGGAGCTGCACTGTGCCACGGGCATCAGCCTGGCCAACGAGCAGGACCGCTGTGCCACGC
CCCACGGTGACAACGCCAGCCTGGAGGCCACATTTGTGAAGAGGTGCTGCCATTGCTGTCTGCTGGGGAG
GGCGGCCCAGGCCCAGGGCCAGAGCTGCGAGTACAGCCTCATGGTTGGCTACCAGTGTGGACAGGTCTTC
CGGGCATGCTGTGTCAAGAGCCAGGAGACCGGAGATTTGGATGTCGGGGGCCTCCAAGAAACGGATAAGA
TCATTGAGGTTGAGGAGGAACAAGAGGACCCATATCTGAATGACCGCTGCCGAGGAGGCGGGCCCTGCAA
GCAGCAGTGCCGAGACACGGGTGACGAGGTGGTCTGCTCCTGCTTCGTGGGCTACCAGCTGCTGTCTGAT
GGTGTCTCCTGTGAAGATGTCAATGAATGCATCACGGGCAGCCACAGCTGCCGGCTTGGAGAATCCTGCA
TCAACACAGTGGGCTCTTTCCGCTGCCAGCGGGACAGCAGCTGCGGGACTGGCTATGAGCTCACAGAGGA
CAATAGCTGCAAAGATATTGACGAGTGTGAGAGTGGTATTCATAACTGCCTCCCCGATTTTATCTGTCAG
AATACTCTGGGATCCTTCCGCTGCCGACCCAAGCTACAGTGCAAGAGTGGCTTTATACAAGATGCTCTAG
GCAACTGTATTGATATCAATGAGTGTTTGAGTATCAGTGCCCCGTGCCCTATTGGGCATACATGCATCAA
CACAGAGGGCTCCTACACGTGCCAGAAGAACGTGCCCAACTGTGGCCGTGGCTACCATCTCAACGAGGAG
GGAACGCGCTGTGTTGATGTGGACGAGTGCGCGCCACCTGCTGAGCCCTGTGGGAAGGGACATCGCTGCG
TGAACTCTCCCGGCAGTTTCCGCTGCGAATGCAAGACGGGTTACTATTTTGACGGCATCAGCAGGATGTG
TGTCGATGTCAACGAGTGCCAGCGCTACCCCGGGCGCCTGTGTGGCCACAAGTGCGAGAACACGCTGGGC
TCCTACCTCTGCAGCTGTTCCGTGGGCTTCCGGCTCTCTGTGGATGGCAGGTCATGTGAAGACATCAATG
AGTGCAGCAGCAGCCCCTGTAGCCAGGAGTGTGCCAACGTCTACGGCTCCTACCAGTGTTACTGCCGGCG
AGGCTACCAGCTCAGCGATGTGGATGGAGTCACCTGTGAAGACATCGACGAGTGCGCCCTGCCCACCGGG
GGCCACATCTGCTCCTACCGCTGCATCAACATCCCTGGAAGCTTCCAGTGCAGCTGCCCCTCGTCTGGCT
ACAGGCTGGCCCCCAATGGCCGCAACTGCCAAGACATTGATGAGTGTGTGACTGGCATCCACAACTGCTC
CATCAACGAGACCTGCTTCAACATCCAGGGCGGCTTCCGCTGCCTGGCCTTCGAGTGCCCTGAGAACTAC
CGCCGCTCCGCAGCCACGCTCCAGCAGGAGAAGACAGACACGGTCCGCTGCATCAAGTCCTGCCGCCCCA
ACGATGTCACATGCGTGTTCGACCCCGTGCACACCATCTCCCACACCGTCATCTCGCTGCCTACCTTCCG
CGAGTTCACCCGCCCTGAAGAGATCATCTTCCTCCGGGCCATCACGCCACCGCATCCTGCCAGCCAGGCT
AACATCATCTTCGACATCACGGAAGGGAACCTGCGGGACTCTTTTGACATCATCAAGCGTTACATGGACG
GCATGACCGTGGGTGTCGTGCGCCAGGTGCGGCCCATCGTGGGCCCATTTCATGCCGTCCTGAAGCTGGA
GATGAACTATGTGGTCGGGGGCGTGGTCTCCCACCGAAATGTTGTCAACGTCCACATCTTCGTCTCTGAG
TACTGGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221597 representing NM_006486
Red=Cloning site Green=Tags(s)

MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKECRMVQEQCCH
SQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVF
RACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSD
GVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQ
NTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEE
GTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTG
GHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENY
RRSAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTVISLPTFREFTRPEEIIFLRAITPPHPASQA
NIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSE
YWF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006486
ORF Size 2109 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006486.3
RefSeq Size 2947 bp
RefSeq ORF 2112 bp
Locus ID 2192
UniProt ID P23142
Cytogenetics 22q13.31
Domains ANATO, EGF_CA, EGF, EGF
Protein Families Secreted Protein
MW 77.24 kDa
Gene Summary Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "FBLN1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Anti-FBLN1 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.