FAK (PTK2) (NM_005607) Human Tagged ORF Clone

CAT#: RC221398

Reviews ()
Write a review

PTK2 (Myc-DDK-tagged)-Human PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2



  "NM_005607" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,281.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PTK2
Synonyms FADK; FADK 1; FAK; FAK1; FRNK; p125FAK; pp125FAK; PPP1R71
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221398 representing NM_005607
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCTCGGCTGACTGCAACCTCTGCCTCCCAGAATATGACAGATACCTAGCATCTAGCAAAATAATGG
CAGCTGCTTACCTTGACCCCAACTTGAATCACACACCAAATTCGAGTACTAAGACTCACCTGGGTACTGG
TATGGAACGTTCTCCTGGTGCAATGGAGCGAGTATTAAAGGTCTTTCATTATTTTGAAAGCAATAGTGAG
CCAACCACCTGGGCCAGTATTATCAGGCATGGAGATGCTACTGATGTCAGGGGCATCATTCAGAAGATAG
TGGACAGTCACAAAGTAAAGCATGTGGCCTGCTATGGATTCCGCCTCAGTCACCTGCGGTCAGAGGAGGT
TCACTGGCTTCACGTGGATATGGGCGTCTCCAGTGTGAGGGAGAAGTATGAGCTTGCTCACCCACCAGAG
GAGTGGAAATATGAATTGAGAATTCGTTATTTGCCAAAAGGATTTCTAAACCAGTTTACTGAAGATAAGC
CAACTTTGAATTTCTTCTATCAACAGGTGAAGAGCGATTATATGTTAGAGATAGCTGATCAAGTGGACCA
GGAAATTGCTTTGAAGTTGGGTTGTCTAGAAATACGGCGATCATACTGGGAGATGCGGGGCAATGCACTA
GAAAAGAAGTCTAACTATGAAGTATTAGAAAAAGATGTTGGTTTAAAGCGATTTTTTCCTAAGAGTTTAC
TGGATTCTGTCAAGGCCAAAACACTAAGAAAACTGATCCAACAAACATTTAGACAATTTGCCAACCTTAA
TAGAGAAGAAAGTATTCTGAAATTCTTTGAGATCCTGTCTCCAGTCTACAGATTTGATAAGGAATGCTTC
AAGTGTGCTCTTGGTTCAAGCTGGATTATTTCAGTGGAACTGGCAATCGGCCCAGAAGAAGGAATCAGTT
ACCTAACGGACAAGGGCTGCAATCCCACACATCTTGCTGACTTCACTCAAGTGCAAACCATTCAGTATTC
AAACAGTGAAGACAAGGACAGAAAAGGAATGCTACAACTAAAAATAGCAGGTGCACCCGAGCCTCTGACA
GTGACGGCACCATCCCTAACCATTGCGGAGAATATGGCTGACCTAATAGATGGGTACTGCCGGCTGGTGA
ATGGAACCTCGCAGTCATTTATCATCAGACCTCAGAAAGAAGGTGAACGGGCTTTGCCATCAATACCAAA
GTTGGCCAACAGCGAAAAGCAAGGCATGCGGACACACGCCGTCTCTGTGTCAGAAACAGATGATTATGCT
GAGATTATAGATGAAGAAGATACTTACACCATGCCCTCAACCAGGGATTATGAGATTCAAAGAGAAAGAA
TAGAACTTGGACGATGTATTGGAGAAGGCCAATTTGGAGATGTACATCAAGGCATTTATATGAGTCCAGA
GAATCCAGCTTTGGCGGTTGCAATTAAAACATGTAAAAACTGTACTTCGGACAGCGTGAGAGAGAAATTT
CTTCAAGAAGCCTTAACAATGCGTCAGTTTGACCATCCTCATATTGTGAAGCTGATTGGAGTCATCACAG
AGAATCCTGTCTGGATAATCATGGAGCTGTGCACACTTGGAGAGCTGAGGTCATTTTTGCAAGTAAGGAA
ATACAGTTTGGATCTAGCATCTTTGATCCTGTATGCCTATCAGCTTAGTACAGCTCTTGCATATCTAGAG
AGCAAAAGATTTGTACACAGGGACATTGCTGCTCGGAATGTTCTGGTGTCCTCAAATGATTGTGTAAAAT
TAGGAGACTTTGGATTATCCCGATATATGGAAGATAGTACTTACTACAAAGCTTCCAAAGGAAAATTGCC
TATTAAATGGATGGCTCCAGAGTCAATCAATTTTCGACGTTTTACCTCAGCTAGTGACGTATGGATGTTT
GGTGTGTGTATGTGGGAGATACTGATGCATGGTGTGAAGCCTTTTCAAGGAGTGAAGAACAATGATGTAA
TCGGTCGAATTGAAAATGGGGAAAGATTACCAATGCCTCCAAATTGTCCTCCTACCCTCTACAGCCTTAT
GACGAAATGCTGGGCCTATGACCCCAGCAGGCGGCCCAGGTTTACTGAACTTAAAGCTCAGCTCAGCACA
ATCCTGGAGGAAGAGAAGGCTCAGCAAGAAGAGCGCATGAGGATGGAGTCCAGAAGACAGGCCACAGTGT
CCTGGGACTCCGGAGGGTCTGATGAAGCACCGCCCAAGCCCAGCAGACCGGGTTATCCCAGTCCGAGGTC
CAGCGAAGGATTTTATCCCAGCCCACAGCACATGGTACAAACCAATCATTACCAGGTTTCTGGCTACCCT
GGTTCACATGGAATCACAGCCATGGCTGGCAGCATCTATCCAGGTCAGGCATCTCTTTTGGACCAAACAG
ATTCATGGAATCATAGACCTCAGGAGATAGCAATGTGGCAGCCCAATGTGGAGGACTCTACAGTATTGGA
CCTGCGAGGGATTGGGCAAGTGTTGCCAACCCATCTGATGGAAGAGCGTCTAATCCGACAGCAACAGGAA
ATGGAAGAAGATCAGCGCTGGCTGGAAAAAGAGGAAAGATTTCTGAAACCTGATGTGAGACTCTCTCGAG
GCAGTATTGACAGGGAGGATGGAAGTCTTCAGGGTCCGATTGGAAACCAACATATATATCAGCCTGTGGG
TAAACCAGATCCTGCAGCTCCACCAAAGAAACCGCCTCGCCCTGGAGCTCCCGGTCATCTGGGAAGCCTT
GCCAGCCTCAGCAGCCCTGCTGACAGCTACAACGAGGGTGTCAAGCTTCAGCCCCAGGAAATCAGCCCCC
CTCCTACTGCCAACCTGGACCGGTCGAATGATAAGGTGTACGAGAATGTGACGGGCCTGGTGAAAGCTGT
CATCGAGATGTCCAGTAAAATCCAGCCAGCCCCACCAGAGGAGTATGTCCCTATGGTGAAGGAAGTCGGC
TTGGCCCTGAGGACATTATTGGCCACTGTGGATGAGACCATTCCCCTCCTACCAGCCAGCACCCACCGAG
AGATTGAGATGGCACAGAAGCTATTGAACTCTGACCTGGGTGAGCTCATCAACAAGATGAAACTGGCCCA
GCAGTATGTCATGACCAGCCTCCAGCAAGAGTACAAAAAGCAAATGCTGACTGCTGCTCACGCCCTGGCT
GTGGATGCCAAAAACTTACTCGATGTCATTGACCAAGCAAGACTGAAAATGCTTGGGCAGACGAGACCAC
AC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221398 representing NM_005607
Red=Cloning site Green=Tags(s)

MISADCNLCLPEYDRYLASSKIMAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSE
PTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPE
EWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNAL
EKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECF
KCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLT
VTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYA
EIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKF
LQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLE
SKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMF
GVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLST
ILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYP
GSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQE
MEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSL
ASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVG
LALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALA
VDAKNLLDVIDQARLKMLGQTRPH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005607
ORF Size 3222 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005607.5
RefSeq Size 4442 bp
RefSeq ORF 3225 bp
Locus ID 5747
Cytogenetics 8q24.3
Domains B41, pkinase, TyrKc, S_TKc, Focal_AT
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Axon guidance, Chemokine signaling pathway, ErbB signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer, VEGF signaling pathway
MW 121.5 kDa
Gene Summary This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]

Other Versions

Other products for "PTK2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


PTK2 (FAK) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.