CRLF2 (NM_022148) Human Tagged ORF Clone

CAT#: RC221190

Reviews ()
Write a review

CRLF2 (Myc-DDK-tagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1



  "NM_022148" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00

USD 686.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CRLF2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CRLF2
Synonyms CRL2; CRLF2Y; TSLPR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221190 representing NM_022148
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCGGCTGGTTCTGCTGTGGGGAGCTGCCGTCTTTCTGCTGGGAGGCTGGATGGCTTTGGGGCAAG
GAGGAGCAGAAGGAGTACAGATTCAGATCATCTACTTCAATTTAGAAACCGTGCAGGTGACATGGAATGC
CAGCAAATACTCCAGGACCAACCTGACTTTCCACTACAGATTCAACGGTGATGAGGCCTATGACCAGTGC
ACCAACTACCTTCTCCAGGAAGGTCACACTTCGGGGTGCCTCCTAGACGCAGAGCAGCGAGACGACATTC
TCTATTTCTCCATCAGGAATGGGACGCACCCCGTTTTCACCGCAAGTCGCTGGATGGTTTATTACCTGAA
ACCCAGTTCCCCGAAGCACGTGAGATTTTCGTGGCATCAGGATGCAGTGACGGTGACGTGTTCTGACCTG
TCCTACGGGGATCTCCTCTATGAGGTTCAGTACCGGAGCCCCTTCGACACCGAGTGGCAGTCCAAACAGG
AAAATACCTGCAACGTCACCATAGAAGGCTTGGATGCCGAGAAGTGTTACTCTTTCTGGGTCAGGGTGAA
GGCTATGGAGGATGTATATGGGCCAGACACATACCCAAGCGACTGGTCAGAGGTGACATGCTGGCAGAGA
GGCGAGATTCGGGATGCCTGTGCAGAGACACCAACGCCTCCCAAACCAAAGCTGTCCAAATTTATTTTAA
TTTCCAGCCTGGCCATCCTTCTGATGGTGTCTCTCCTCCTTCTGTCTTTATGGAAATTATGGAGAGTGAG
GAAGTTTCTCATTCCCAGCGTGCCAGACCCGAAATCCATCTTCCCCGGGCTCTTTGAGATACACCAAGGG
AACTTCCAGGAGTGGATCACAGACACCCAGAACGTGGCCCACCTCCACAAGATGGCAGGTGCAGAGCAAG
AAAGTGGCCCCGAGGAGCCCCTGGTAGTCCAGTTGGCCAAGACTGAAGCCGAGTCTCCCAGGATGCTGGA
CCCACAGACCGAGGAGAAAGAGGCCTCTGGGGGATCCCTCCAGCTTCCCCACCAGCCCCTCCAAGGCGGT
GATGTGGTCACAATCGGGGGCTTCACCTTTGTGATGAATGACCGCTCCTACGTGGCGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221190 representing NM_022148
Red=Cloning site Green=Tags(s)

MGRLVLLWGAAVFLLGGWMALGQGGAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQC
TNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDL
SYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQR
GEIRDACAETPTPPKPKLSKFILISSLAILLMVSLLLLSLWKLWRVRKFLIPSVPDPKSIFPGLFEIHQG
NFQEWITDTQNVAHLHKMAGAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGG
DVVTIGGFTFVMNDRSYVAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022148
ORF Size 1110 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022148.4
RefSeq Size 1579 bp
RefSeq ORF 1116 bp
Locus ID 64109
UniProt ID Q9HC73
Cytogenetics X;Y
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
MW 41.8 kDa
Gene Summary This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pathways, which control processes such as cell proliferation and development of the hematopoietic system. Rearrangement of this gene with immunoglobulin heavy chain gene (IGH) on chromosome 14, or with P2Y purinoceptor 8 gene (P2RY8) on the same X or Y chromosomes is associated with B-progenitor acute lymphoblastic leukemia (ALL) and Down syndrome ALL. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


CRLF2 rabbit polyclonal antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.