FATP2 (SLC27A2) (NM_003645) Human Tagged ORF Clone

CAT#: RC221033

Reviews ()
Write a review

SLC27A2 (Myc-DDK-tagged)-Human solute carrier family 27 (fatty acid transporter), member 2 (SLC27A2), transcript variant 1



  "NM_003645" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 646.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC27A2
Synonyms ACSVL1; FACVL1; FATP2; hFACVL1; HsT17226; VLACS; VLCS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221033 representing NM_003645
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTTCCGCCATCTACACAGTCCTGGCGGGACTGCTGTTCCTGCCGCTCCTGGTGAACCTCTGCTGCC
CATACTTCTTCCAGGACATAGGCTACTTCTTGAAGGTGGCCGCCGTGGGCCGGAGGGTGCGCAGCTACGG
GAAGCGGCGGCCGGCGCGCACCATCCTGCGGGCGTTCCTGGAGAAAGCGCGCCAGACGCCACACAAGCCT
TTTCTGCTCTTCCGCGACGAGACTCTCACCTACGCGCAGGTGGACCGGCGCAGCAATCAAGTGGCCCGGG
CGCTGCACGACCACCTCGGCCTGCGCCAGGGAGACTGCGTGGCGCTCCTTATGGGTAACGAGCCGGCCTA
CGTGTGGCTGTGGCTGGGGCTGGTGAAGCTGGGCTGTGCCATGGCGTGCCTCAATTACAACATCCGCGCG
AAGTCCCTGCTGCACTGCTTCCAGTGCTGCGGGGCGAAGGTGCTGCTGGTGTCGCCAGAACTACAAGCAG
CTGTCGAAGAGATACTGCCAAGCCTTAAAAAAGATGATGTGTCCATCTATTATGTGAGCAGAACTTCTAA
CACAGATGGGATTGACTCTTTCCTGGACAAAGTGGATGAAGTATCAACTGAACCTATCCCAGAGTCATGG
AGGTCTGAAGTCACTTTTTCCACTCCTGCCTTATACATTTATACTTCTGGAACCACAGGTCTTCCAAAAG
CAGCCATGATCACTCATCAGCGCATATGGTATGGAACTGGCCTCACTTTTGTAAGCGGATTGAAGGCAGA
TGATGTCATCTATATCACTCTGCCCTTTTACCACAGTGCTGCACTACTGATTGGCATTCACGGATGTATT
GTGGCTGGTGCTACTCTTGCCTTGCGGACTAAATTTTCAGCCAGCCAGTTTTGGGATGACTGCAGAAAAT
ACAACGTCACTGTCATTCAGTATATCGGTGAACTGCTTCGGTATTTATGCAACTCACCACAGAAACCAAA
TGACCGTGATCATAAAGTGAGACTGGCACTGGGAAATGGCTTACGAGGAGATGTGTGGAGACAATTTGTC
AAGAGATTTGGGGACATATGCATCTATGAGTTCTATGCTGCCACTGAAGGCAATATTGGATTTATGAATT
ATGCGAGAAAAGTTGGTGCTGTTGGAAGAGTAAACTACCTACAGAAAAAAATCATAACTTATGACCTGAT
TAAATATGATGTGGAGAAAGATGAACCTGTCCGTGATGAAAATGGATATTGCGTCAGAGTTCCCAAAGGT
GAAGTTGGACTTCTGGTTTGCAAAATCACACAACTTACACCATTTAATGGCTATGCTGGAGCAAAGGCTC
AGACAGAGAAGAAAAAACTGAGAGATGTCTTTAAGAAAGGAGACCTCTATTTCAACAGTGGAGATCTCTT
AATGGTTGACCATGAAAATTTCATCTATTTCCACGACAGAGTTGGAGATACATTCCGGTGGAAAGGGGAA
AATGTGGCCACCACTGAAGTTGCTGATACAGTTGGACTGGTTGATTTTGTCCAAGAAGTAAATGTTTATG
GAGTGCATGTGCCAGATCATGAGGGTCGCATTGGCATGGCCTCCATCAAAATGAAAGAAAACCATGAATT
TGATGGAAAGAAACTCTTTCAGCACATTGCTGATTACCTACCTAGTTATGCAAGGCCCCGGTTTCTAAGA
ATACAGGACACCATTGAGATCACTGGAACTTTTAAACACCGCAAAATGACCCTGGTGGAGGAGGGCTTTA
ACCCTGCTGTCATCAAAGATGCCTTGTATTTCTTGGATGACACAGCAAAAATGTATGTGCCTATGACTGA
GGACATCTATAATGCCATAAGTGCTAAAACCCTGAAACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221033 representing NM_003645
Red=Cloning site Green=Tags(s)

MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFLEKARQTPHKP
FLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRA
KSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESW
RSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCI
VAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFV
KRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGE
NVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLR
IQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003645
ORF Size 1860 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003645.4
RefSeq Size 2343 bp
RefSeq ORF 1863 bp
Locus ID 11001
UniProt ID O14975
Cytogenetics 15q21.2
Domains AMP-binding
Protein Families Transmembrane
Protein Pathways PPAR signaling pathway
MW 70.1 kDa
Gene Summary The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2009]

Other Versions

Other products for "SLC27A2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-SLC27A2 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.