cGKI (PRKG1) (NM_006258) Human Tagged ORF Clone

CAT#: RC220986

Reviews ()
Write a review

PRKG1 (Myc-DDK-tagged)-Human protein kinase, cGMP-dependent, type I (PRKG1), transcript variant 2



  "NM_006258" in other vectors (6)

Reconstitution Protocol

USD 628.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PRKG1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRKG1
Synonyms AAT8; cGK; cGK 1; cGK1; cGKI; cGKI-alpha; cGKI-BETA; PKG; PKG1; PRKG1B; PRKGR1B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220986 representing NM_006258
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACCTTGCGGGATTTACAGTACGCGCTCCAGGAGAAGATCGAGGAGCTGAGGCAGCGGGATGCTC
TCATCGACGAGCTGGAGCTGGAGTTGGATCAGAAGGACGAACTGATCCAGAAGCTGCAGAACGAGCTGGA
CAAGTACCGCTCGGTGATCCGACCAGCCACCCAGCAGGCGCAGAAGCAGAGCGCGAGCACCTTGCAGGGC
GAGCCGCGCACCAAGCGGCAGGCGATCTCCGCCGAGCCCACCGCCTTCGACATCCAGGATCTCAGCCATG
TGACCCTGCCCTTCTACCCCAAGAGCCCACAGTCCAAGGATCTTATAAAGGAAGCTATCCTTGACAATGA
CTTTATGAAGAACTTGGAGCTGTCGCAGATCCAGGAGATTGTGGATTGTATGTACCCGGTGGAGTATGGC
AAGGACAGTTGCATCATCAAAGAAGGAGACGTGGGGTCACTGGTGTATGCCATGGAAGATGGTAAGGTTG
AAGTTACAAAAGAAGGTGTGAAGTTGTGTACCATGGGTCCAGGAAAAGTGTTTGGGGAATTGGCTATTCT
TTACAACTGTACCCGGACAGCGACCGTCAAGACTCTTGTAAATGTAAAACTCTGGGCCATTGATCGACAA
TGTTTTCAAACAATAATGATGAGGACAGGACTCATCAAGCATACCGAGTATATGGAATTTTTAAAAAGCG
TTCCAACATTCCAGAGCCTTCCTGAAGAGATCCTCAGCAAGCTTGCTGATGTCCTTGAAGAGACCCACTA
TGAAAATGGAGAATATATTATCAGGCAAGGTGCAAGAGGGGACACCTTCTTTATCATCAGCAAAGGAACG
GTAAATGTCACTCGTGAAGACTCACCGAGTGAAGACCCAGTCTTTCTTAGAACTTTAGGAAAAGGAGACT
GGTTTGGAGAGAAAGCCTTGCAGGGGGAAGATGTGAGAACAGCAAACGTAATTGCTGCAGAAGCTGTAAC
CTGCCTTGTGATTGACAGAGACTCTTTTAAACATTTGATTGGAGGGCTGGATGATGTTTCTAATAAAGCA
TATGAAGATGCAGAAGCTAAAGCAAAATATGAAGCTGAAGCGGCTTTCTTCGCCAACCTGAAGCTGTCTG
ATTTCAACATCATTGATACCCTTGGAGTTGGAGGTTTCGGACGAGTAGAACTGGTCCAGTTGAAAAGTGA
AGAATCCAAAACGTTTGCAATGAAGATTCTCAAGAAACGTCACATTGTGGACACAAGACAGCAGGAGCAC
ATCCGCTCAGAGAAGCAGATCATGCAGGGGGCTCATTCCGATTTCATAGTGAGACTGTACAGAACATTTA
AGGACAGCAAATATTTGTATATGTTGATGGAAGCTTGTCTAGGTGGAGAGCTCTGGACCATTCTCAGGGA
TAGAGGTTCGTTTGAAGATTCTACAACCAGATTTTACACAGCATGTGTGGTAGAAGCTTTTGCCTATCTG
CATTCCAAAGGAATCATTTACAGGGACCTCAAGCCAGAAAATCTCATCCTAGATCACCGAGGTTATGCCA
AACTGGTTGATTTTGGCTTTGCAAAGAAAATAGGATTTGGAAAGAAAACATGGACTTTTTGTGGGACTCC
AGAGTATGTAGCCCCAGAGATCATCCTGAACAAAGGCCATGACATTTCAGCCGACTACTGGTCACTGGGA
ATCCTAATGTATGAACTCCTGACTGGCAGCCCACCTTTCTCAGGCCCAGATCCTATGAAAACCTATAACA
TCATATTGAGGGGGATTGACATGATAGAATTTCCAAAGAAGATTGCCAAAAATGCTGCTAATTTAATTAA
AAAACTATGCAGGGACAATCCATCAGAAAGATTAGGGAATTTGAAAAATGGAGTAAAAGACATTCAAAAG
CACAAATGGTTTGAGGGCTTTAACTGGGAAGGCTTAAGAAAAGGTACCTTGACACCTCCTATAATACCAA
GTGTTGCATCACCCACAGACACAAGTAATTTTGACAGTTTCCCTGAGGACAACGATGAACCACCACCTGA
TGACAACTCAGGATGGGATATAGACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220986 representing NM_006258
Red=Cloning site Green=Tags(s)

MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQG
EPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYG
KDSCIIKEGDVGSLVYAMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQ
CFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGT
VNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKA
YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYL
HSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLG
ILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQK
HKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006258
ORF Size 2058 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006258.4
RefSeq Size 3740 bp
RefSeq ORF 2061 bp
Locus ID 5592
UniProt ID Q13976
Cytogenetics 10q11.23-q21.1
Domains cNMP, pkinase, S_TK_X, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Gap junction, Long-term depression, Olfactory transduction, Vascular smooth muscle contraction
MW 77.6 kDa
Gene Summary Mammals have three different isoforms of cyclic GMP-dependent protein kinase (Ialpha, Ibeta, and II). These PRKG isoforms act as key mediators of the nitric oxide/cGMP signaling pathway and are important components of many signal transduction processes in diverse cell types. This PRKG1 gene on human chromosome 10 encodes the soluble Ialpha and Ibeta isoforms of PRKG by alternative transcript splicing. A separate gene on human chromosome 4, PRKG2, encodes the membrane-bound PRKG isoform II. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, preventing platelet aggregation, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity. [provided by RefSeq, Sep 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.