SYVN1 (NM_172230) Human Tagged ORF Clone

CAT#: RC220540

SYVN1 (Myc-DDK-tagged)-Human synovial apoptosis inhibitor 1, synoviolin (SYVN1), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name SYVN1 (NM_172230) Human Tagged ORF Clone
Symbol SYVN1
Synonyms DER3; HRD1
Vector pCMV6-Entry
Sequence Data
>RC220540 representing NM_172230
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCGCACGGCAGTGATGATGGCGGCCAGCCTGGCGCTGACCGGGGCTGTGGTGGCTCACGCCTACT
ACCTCAAACACCAGTTCTACCCCACTGTGGTGTACCTGACCAAGTCCAGCCCCAGCATGGCAGTCCTGTA
CATCCAGGCCTTTGTCCTTGTCTTCCTTCTGGGCAAGGTGATGGGCAAGGTGTTCTTTGGGCAACTGAGG
GCAGCAGAGATGGAGCACCTTCTGGAACGTTCCTGGTACGCCGTCACAGAGACTTGTCTGGCCTTCACCG
TTTTTCGGGATGACTTCAGCCCCCGCTTTGTTGCACTCTTCACTCTTCTTCTCTTCCTCAAATGTTTCCA
CTGGCTGGCTGAGGACCGTGTGGACTTTATGGAACGCAGCCCCAACATCTCCTGGCTCTTTCACTGCCGC
ATTGTCTCTCTTATGTTCCTCCTGGGCATCCTGGACTTCCTCTTCGTCAGCCACGCCTATCACAGCATCC
TGACCCGTGGGGCCTCTGTGCAGCTGGTGTTTGGCTTTGAGTATGCCATCCTGATGACGATGGTGCTCAC
CATCTTCATCAAGTATGTGCTGCACTCCGTGGACCTCCAGAGTGAGAACCCCTGGGACAACAAGGCTGTG
TACATGCTCTACACAGAGCTGTTTACAGGCTTCATCAAGGTTCTGCTGTACATGGCCTTCATGACCATCA
TGATCAAGGTGCACACCTTCCCACTCTTTGCCATCCGGCCCATGTACCTGGCCATGAGACAGTTCAAGAA
AGCTGTGACAGATGCCATCATGTCTCGCCGAGCCATCCGCAACATGAACACCCTGTATCCAGATGCCACC
CCAGAGGAGCTCCAGGCAATGGACAATGTCTGCATCATCTGCCGAGAAGAGATGGTGACTGGTGCCAAGA
GACTGCCCTGCAACCACATTTTCCATACCAGCTGCCTGCGCTCCTGGTTCCAGCGGCAGCAGACCTGCCC
CACCTGCCGTATGGATGTCCTTCGTGCATCGCTGCCAGCGCAGTCACCACCACCCCCGGAGCCTGCGGAT
CAGGGGCCACCCCCTGCCCCCCACCCCCCACCACTCTTGCCTCAGCCCCCCAACTTCCCCCAGGGCCTCC
TGCCTCCTTTTCCTCCAGGCATGTTCCCACTGTGGCCCCCCATGGGCCCCTTTCCACCTGTCCCGCCTCC
CCCCAGCTCAGGAGAGGCTGTGGCTCCTCCATCCACCAGTGCAGCAGCCCTTTCTCGGCCCAGTGGAGCA
GCTACAACCACAGCTGCTGGCACCAGTGCTACTGCTGCTTCTGCCACAGCATCTGGCCCAGGCTCTGGCT
CTGCCCCAGAGGCTGGCCCTGCCCCTGGTTTCCCCTTCCCTCCTCCCTGGATGGGTATGCCCCTGCCTCC
ACCCTTTGCCTTCCCCCCAATGCCTGTGCCCCCTGCGGGCTTTGCTGGGCTGACCCCAGAGGAGCTACGA
GCTCTGGAGGGCCATGAGCGGCAGCACCTGGAGGCCCGGCTGCAGAGCCTGCGTAACATCCACACACTGC
TGGACGCCGCCATGCTGCAGATCAACCAGTACCTCACCGTGCTGGCCTCCTTGGGGCCCCCCCGGCCTGC
CACTTCAGTCAACTCCACTGAGGAGACTGCCACTACAGTTGTTGCTGCTGCCTCCTCCACCAGCATCCCT
AGCTCAGAGGCCACGACCCCAACCCCAGGAGCCTCCCCACCAGCCCCTGAAATGGAAAGGCCTCCAGCTC
CTGAGTCAGTGGGCACAGAGGAGATGCCTGAGGATGGAGAGCCCGATGCAGCAGAGCTCCGCCGGCGCCG
CCTGCAGAAGCTGGAGTCTCCTGTTGCCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220540 representing NM_172230
Red=Cloning site Green=Tags(s)

MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLR
AAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCR
IVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSENPWDNKAV
YMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDAT
PEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPAD
QGPPPAPHPPPLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGA
ATTTAAGTSATAASATASGPGSGSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELR
ALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIP
SSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDAAELRRRRLQKLESPVAH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_172230
ORF Size 1851 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172230.1, NM_172230.2, NP_757385
RefSeq Size 3074
RefSeq ORF 1854
Locus ID 84447
Cytogenetics 11q13.1
Protein Families Transmembrane, Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
MW 67.5 kDa
Gene Summary This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. Sequence analysis identified two transcript variants that encode different isoforms. [provided by RefSeq, May 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)