SYVN1 (NM_172230) Human Tagged ORF Clone

CAT#: RG220540

  • TrueORF®

SYVN1 (tGFP-tagged) - Human synovial apoptosis inhibitor 1, synoviolin (SYVN1), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_172230" in other vectors (6)

Reconstitution Protocol

USD 774.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
    • 400 ul

USD 580.00

Other products for "SYVN1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SYVN1
Synonyms DER3; HRD1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG220540 representing NM_172230
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCGCACGGCAGTGATGATGGCGGCCAGCCTGGCGCTGACCGGGGCTGTGGTGGCTCACGCCTACT
ACCTCAAACACCAGTTCTACCCCACTGTGGTGTACCTGACCAAGTCCAGCCCCAGCATGGCAGTCCTGTA
CATCCAGGCCTTTGTCCTTGTCTTCCTTCTGGGCAAGGTGATGGGCAAGGTGTTCTTTGGGCAACTGAGG
GCAGCAGAGATGGAGCACCTTCTGGAACGTTCCTGGTACGCCGTCACAGAGACTTGTCTGGCCTTCACCG
TTTTTCGGGATGACTTCAGCCCCCGCTTTGTTGCACTCTTCACTCTTCTTCTCTTCCTCAAATGTTTCCA
CTGGCTGGCTGAGGACCGTGTGGACTTTATGGAACGCAGCCCCAACATCTCCTGGCTCTTTCACTGCCGC
ATTGTCTCTCTTATGTTCCTCCTGGGCATCCTGGACTTCCTCTTCGTCAGCCACGCCTATCACAGCATCC
TGACCCGTGGGGCCTCTGTGCAGCTGGTGTTTGGCTTTGAGTATGCCATCCTGATGACGATGGTGCTCAC
CATCTTCATCAAGTATGTGCTGCACTCCGTGGACCTCCAGAGTGAGAACCCCTGGGACAACAAGGCTGTG
TACATGCTCTACACAGAGCTGTTTACAGGCTTCATCAAGGTTCTGCTGTACATGGCCTTCATGACCATCA
TGATCAAGGTGCACACCTTCCCACTCTTTGCCATCCGGCCCATGTACCTGGCCATGAGACAGTTCAAGAA
AGCTGTGACAGATGCCATCATGTCTCGCCGAGCCATCCGCAACATGAACACCCTGTATCCAGATGCCACC
CCAGAGGAGCTCCAGGCAATGGACAATGTCTGCATCATCTGCCGAGAAGAGATGGTGACTGGTGCCAAGA
GACTGCCCTGCAACCACATTTTCCATACCAGCTGCCTGCGCTCCTGGTTCCAGCGGCAGCAGACCTGCCC
CACCTGCCGTATGGATGTCCTTCGTGCATCGCTGCCAGCGCAGTCACCACCACCCCCGGAGCCTGCGGAT
CAGGGGCCACCCCCTGCCCCCCACCCCCCACCACTCTTGCCTCAGCCCCCCAACTTCCCCCAGGGCCTCC
TGCCTCCTTTTCCTCCAGGCATGTTCCCACTGTGGCCCCCCATGGGCCCCTTTCCACCTGTCCCGCCTCC
CCCCAGCTCAGGAGAGGCTGTGGCTCCTCCATCCACCAGTGCAGCAGCCCTTTCTCGGCCCAGTGGAGCA
GCTACAACCACAGCTGCTGGCACCAGTGCTACTGCTGCTTCTGCCACAGCATCTGGCCCAGGCTCTGGCT
CTGCCCCAGAGGCTGGCCCTGCCCCTGGTTTCCCCTTCCCTCCTCCCTGGATGGGTATGCCCCTGCCTCC
ACCCTTTGCCTTCCCCCCAATGCCTGTGCCCCCTGCGGGCTTTGCTGGGCTGACCCCAGAGGAGCTACGA
GCTCTGGAGGGCCATGAGCGGCAGCACCTGGAGGCCCGGCTGCAGAGCCTGCGTAACATCCACACACTGC
TGGACGCCGCCATGCTGCAGATCAACCAGTACCTCACCGTGCTGGCCTCCTTGGGGCCCCCCCGGCCTGC
CACTTCAGTCAACTCCACTGAGGAGACTGCCACTACAGTTGTTGCTGCTGCCTCCTCCACCAGCATCCCT
AGCTCAGAGGCCACGACCCCAACCCCAGGAGCCTCCCCACCAGCCCCTGAAATGGAAAGGCCTCCAGCTC
CTGAGTCAGTGGGCACAGAGGAGATGCCTGAGGATGGAGAGCCCGATGCAGCAGAGCTCCGCCGGCGCCG
CCTGCAGAAGCTGGAGTCTCCTGTTGCCCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG220540 representing NM_172230
Red=Cloning site Green=Tags(s)

MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLR
AAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCR
IVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSENPWDNKAV
YMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDAT
PEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPAD
QGPPPAPHPPPLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGA
ATTTAAGTSATAASATASGPGSGSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELR
ALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIP
SSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDAAELRRRRLQKLESPVAH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_172230
ORF Size 1851 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_172230.3
RefSeq Size 3074 bp
RefSeq ORF 1854 bp
Locus ID 84447
UniProt ID Q86TM6
Cytogenetics 11q13.1
Protein Families Druggable Genome, Transmembrane
Protein Pathways Ubiquitin mediated proteolysis
Gene Summary This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. Sequence analysis identified two transcript variants that encode different isoforms. [provided by RefSeq, May 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.