ADCY3 (NM_004036) Human Tagged ORF Clone

CAT#: RC220272

Reviews ()
Write a review

ADCY3 (Myc-DDK-tagged)-Human adenylate cyclase 3 (ADCY3)



  "NM_004036" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 997.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADCY3
Synonyms AC-III; AC3; BMIQ19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220272 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAGGAACCAGGGCTTCTCCGAGCCCGAATACTCGGCCGAGTACTCAGCCGAGTACTCCGTCAGCC
TGCCCTCCGACCCTGACCGCGGGGTGGGCCGGACCCATGAAATCTCGGTCCGGAACTCGGGCTCCTGCCT
GTGCCTGCCTCGCTTCATGCGGCTGACTTTCGTGCCGGAGTCCTTGGAGAACCTCTACCAGACCTACTTC
AAAAGGCAGCGCCACGAGACCCTGCTGGTGCTGGTGGTCTTTGCAGCCCTCTTTGACTGCTACGTGGTGG
TCATGTGTGCTGTGGTCTTCTCCAGCGACAAGCTGGCTTCCCTCGCCGTGGCTGGAATTGGACTGGTGTT
GGACATCATCCTCTTCGTGCTCTGCAAAAAGGGGCTGCTCCCGGACCGGGTCACCCGCAGAGTGCTGCCC
TACGTGCTGTGGCTGCTCATAACCGCCCAGATCTTCTCCTACCTGGGCCTGAACTTCGCGCGTGCCCACG
CGGCTAGTGACACGGTGGGCTGGCAGGTCTTCTTTGTCTTCTCCTTCTTCATCACGCTGCCCCTCAGCCT
CAGCCCCATCGTGATCATCTCCGTGGTCTCCTGTGTGGTGCACACGTTGGTCCTGGGGGTCACCGTGGCC
CAGCAGCAGCAGGAGGAGCTCAAGGGGATGCAGCTGCTGCGGGAGATCCTGGCCAACGTCTTCCTCTACC
TGTGCGCCATCGCTGTGGGCATCATGTCCTACTACATGGCTGACCGCAAGCACCGCAAGGCCTTCCTGGA
GGCCCGCCAGTCGCTGGAGGTGAAGATGAACCTGGAAGAGCAGAGCCAGCAGCAGGAGAACCTCATGCTT
TCCATCCTGCCCAAGCACGTGGCTGACGAGATGCTGAAAGACATGAAGAAAGACGAGAGCCAGAAGGACC
AGCAGCAGTTCAACACCATGTACATGTACCGTCACGAGAACGTCAGCATCCTCTTTGCCGACATCGTGGG
CTTTACCCAGCTGTCTTCTGCCTGCAGTGCCCAGGAGCTTGTGAAGCTGCTCAACGAGCTCTTTGCCCGC
TTTGACAAGCTGGCAGCTAAATACCACCAGCTGCGGATTAAGATCCTGGGCGACTGCTACTACTGCATCT
GCGGCTTGCCCGACTACCGGGAGGACCACGCCGTCTGCTCCATCCTCATGGGGCTGGCCATGGTGGAGGC
CATCTCGTATGTGCGGGAGAAGACCAAGACTGGGGTGGACATGCGTGTGGGGGTGCACACGGGCACCGTG
CTGGGGGGCGTCCTGGGCCAGAAGCGCTGGCAGTACGACGTGTGGTCGACTGATGTCACTGTAGCCAACA
AGATGGAGGCCGGCGGCATCCCTGGGCGCGTGCACATCTCCCAGAGCACCATGGACTGCCTGAAAGGGGA
GTTTGATGTGGAGCCAGGCGATGGGGGCAGCCGCTGTGATTACCTAGAAGAGAAGGGTATTGAAACCTAC
CTCATCATTGCCTCCAAGCCAGAGGTGAAGAAAACAGCCACCCAGAATGGCCTCAATGGCTCGGCCCTGC
CCAATGGAGCACCAGCTTCCTCAAAGTCCAGCTCCCCTGCCCTCATTGAGACCAAGGAGCCCAACGGGAG
TGCCCACAGCAGTGGGTCCACGTCGGAGAAGCCCGAGGAGCAGGATGCCCAGGCCGACAACCCCTCATTC
CCCAACCCACGCCGGAGGCTGCGCCTGCAGGACCTGGCTGACCGAGTGGTGGATGCCTCTGAAGATGAGC
ACGAGCTCAACCAGCTGCTCAACGAGGCCCTGCTTGAGCGAGAGTCCGCCCAAGTAGTAAAGAAGAGAAA
CACCTTCCTCTTGTCCATGCGGTTCATGGACCCCGAGATGGAAACCCGCTACTCGGTGGAGAAGGAGAAG
CAGAGTGGGGCTGCCTTCAGCTGCTCCTGCGTCGTCCTGCTCTGCACGGCCCTGGTCGAGATACTCATCG
ACCCCTGGCTAATGACAAACTATGTGACCTTCATGGTGGGGGAGATTCTGCTCCTCATCCTGACCATCTG
CTCCCTGGCTGCCATCTTTCCCCGGGCCTTTCCTAAGAAGCTTGTGGCCTTCTCAACTTGGATTGACCGG
ACCCGCTGGGCCAGGAACACCTGGGCCATGCTCGCCATCTTCATCCTGGTGATGGCAAATGTCGTGGACA
TGCTCAGCTGTCTCCAGTACTACACGGGACCCAGCAATGCAACGGCAGGGATGGAAACGGAGGGCAGCTG
CCTGGAGAACCCCAAGTATTACAACTATGTGGCCGTGCTGTCCCTCATCGCCACCATCATGCTGGTGCAG
GTCAGCCACATGGTGAAGCTCACGCTCATGCTGCTCGTCGCAGGCGCCGTGGCCACCATCAACCTCTATG
CCTGGCGTCCCGTCTTTGATGAATACGACCACAAGCGTTTTCGGGAGCACGACTTACCTATGGTGGCCTT
AGAGCAGATGCAAGGATTCAACCCTGGGCTCAATGGCACTGACAGGCTGCCCCTGGTGCCTTCCAAGTAC
TCTATGACGGTGATGGTGTTCCTCATGATGCTCAGCTTCTACTACTTCTCCCGCCACGTAGAAAAACTGG
CACGGACACTTTTCTTGTGGAAGATTGAGGTCCACGACCAGAAGGAACGTGTCTATGAGATGCGACGCTG
GAACGAGGCCTTGGTCACCAACATGTTGCCTGAGCACGTGGCACGCCATTTCCTGGGGTCCAAGAAGAGA
GATGAGGAGCTGTATAGCCAGACGTATGATGAGATTGGAGTCATGTTTGCCTCCCTGCCCAACTTTGCTG
ACTTCTACACAGAGGAGAGCATCAACAATGGTGGTATTGAGTGTCTGCGTTTCCTCAATGAAATCATCTC
AGATTTTGACTCTCTCCTGGACAATCCCAAGTTCCGGGTGATCACCAAGATCAAAACCATTGGCAGCACG
TATATGGCGGCTTCAGGAGTCACCCCCGATGTCAACACCAATGGCTTTGCCAGCTCCAACAAGGAAGACA
AGTCCGAGAGAGAGCGCTGGCAGCACCTGGCTGACCTGGCCGACTTCGCGCTGGCCATGAAGGATACGCT
CACCAACATCAACAACCAGTCCTTCAATAACTTCATGCTGCGCATAGGCATGAACAAAGGCGGGGTTCTG
GCTGGGGTCATCGGAGCCCGGAAACCACACTACGACATCTGGGGCAATACAGTCAATGTAGCCAGCAGGA
TGGAGTCCACGGGGGTCATGGGCAACATTCAGGTGGTAGAAGAAACCCAAGTCATCCTCCGAGAGTACGG
CTTCCGCTTTGTGAGGCGAGGCCCCATCTTTGTGAAGGGGAAGGGGGAGCTGCTGACCTTCTTCTTGAAG
GGGCGGGATAAGCTAGCCACCTTCCCCAATGGCCCCTCTGTCACACTGCCCCACCAGGTGGTGGACAACT
CC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220272 protein sequence
Red=Cloning site Green=Tags(s)

MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYF
KRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDIILFVLCKKGLLPDRVTRRVLP
YVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVA
QQQQEELKGMQLLREILANVFLYLCAIAVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLML
SILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFAR
FDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCDYLEEKGIETY
LIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHSSGSTSEKPEEQDAQADNPSF
PNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLSMRFMDPEMETRYSVEKEK
QSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDR
TRWARNTWAMLAIFILVMANVVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQ
VSHMVKLTLMLLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKR
DEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGST
YMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVL
AGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLK
GRDKLATFPNGPSVTLPHQVVDNS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004036
ORF Size 3432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004036.5
RefSeq Size 4410 bp
RefSeq ORF 3435 bp
Locus ID 109
UniProt ID O60266
Cytogenetics 2p23.3
Domains CYCc
Protein Families Druggable Genome, Transmembrane
Protein Pathways Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Melanogenesis, Olfactory transduction, Oocyte meiosis, Progesterone-mediated oocyte maturation, Purine metabolism, Vascular smooth muscle contraction, Vibrio cholerae infection
MW 129 kDa
Gene Summary This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involved in a number of physiological and pathophysiological metabolic processes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Other Versions

Other products for "ADCY3"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-ADCY3 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.