DDX27 (NM_017895) Human Tagged ORF Clone

CAT#: RC219725

DDX27 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 (DDX27)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DDX27 (NM_017895) Human Tagged ORF Clone
Symbol DDX27
Synonyms dJ686N3.1; DRS1; Drs1p; HSPC259; PP3241; RHLP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC219725 representing NM_017895
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTACTTGCGCAAAGACGACGAGGAGGCTGCGAAAAGTTAAGGGCCGGACCGCAGGCTGTGCTCGCTT
CCGGAAGTGGCTTCTGCGACAACATGCTTGCGGACCTCGGCTTAATCGGAACCATAGGCGAGGATGACGA
GGTGCCGGTGGAGCCCGAGTCTGACTCCGGGGACGAGGAAGAGGAGGGGCCCATTGTGCTGGGCAGACGA
CAAAAAGCTTTGGGGAAGAACCGCAGTGCTGATTTCAACCCTGATTTCGTTTTCACTGAGAAGGAGGGGA
CGTACGATGGCAGCTGGGCCCTGGCTGATGTCATGAGCCAACTCAAGAAGAAGAGGGCAGCCACTACATT
AGATGAGAAGATTGAGAAAGTTCGAAAGAAAAGGAAAACAGAGGATAAAGAAGCCAAGTCTGGGAAGTTG
GAAAAGGAGAAAGAAGCAAAGGAAGGCTCTGAACCAAAGGAGCAGGAAGACCTTCAAGAGAATGATGAGG
AAGGCTCAGAAGATGAAGCCTCGGAGACTGACTACTCATCAGCTGATGAGAACATCCTCACCAAAGCAGA
TACACTCAAAGTAAAGGATCGGAAGAAGAAGAAGAAGAAAGGACAGGAAGCAGGAGGATTTTTTGAAGAT
GCATCTCAGTACGATGAAAACCTCTCGTTCCAGGACATGAACCTTTCCCGCCCTCTTCTGAAGGCCATTA
CAGCCATGGGCTTCAAGCAGCCCACCCCGATCCAGAAGGCGTGCATACCTGTGGGTCTATTGGGGAAGGA
CATCTGTGCCTGTGCAGCCACTGGGACAGGTAAAACTGCCGCCTTTGCCCTGCCTGTTTTGGAGCGTCTG
ATTTATAAACCCCGCCAGGCTCCAGTCACCCGCGTGCTGGTGCTAGTGCCCACCCGAGAGCTGGGCATCC
AGGTGCACTCTGTCACCAGACAGCTGGCCCAGTTCTGCAACATCACCACCTGCCTGGCTGTGGGCGGCTT
GGATGTGAAGTCTCAGGAAGCAGCTCTTCGGGCAGCGCCTGACATCCTCATCGCCACCCCAGGCCGGCTC
ATCGATCACCTCCACAACTGCCCTTCCTTCCACCTGAGCAGCATCGAGGTGCTCATCCTGGACGAGGCTG
ACAGGATGCTGGATGAGTACTTTGAGGAGCAGATGAAGGAGATCATCCGAATGTGTTCCCACCACCGCCA
GACCATGCTCTTCTCGGCCACCATGACAGACGAGGTGAAAGATCTGGCTTCTGTCTCCTTGAAGAATCCT
GTCCGGATATTTGTGAACAGCAACACAGATGTGGCTCCCTTCCTGCGGCAGGAGTTCATCCGGATCCGGC
CTAATCGTGAAGGAGACCGGGAAGCCATCGTGGCAGCTTTGTTGACGAGGACCTTCACTGACCATGTGAT
GCTGTTCACGCAAACCAAGAAGCAGGCCCACCGCATGCACATCCTCCTGGGGCTCATGGGGCTGCAGGTG
GGTGAGCTCCATGGCAACTTGTCACAGACGCAGCGGCTGGAGGCCCTCCGGCGTTTTAAGGATGAACAGA
TTGACATCCTCGTGGCCACTGATGTGGCAGCCCGTGGACTTGACATTGAGGGGGTCAAAACGGTAATCAA
CTTCACAATGCCTAATACCATCAAACATTATGTCCACCGGGTGGGGCGAACAGCACGTGCTGGCAGGGCT
GGGCGCTCAGTCTCTCTGGTGGGAGAAGATGAGCGGAAGATGCTGAAGGAGATTGTAAAAGCTGCCAAGG
CCCCTGTGAAGGCCAGGATACTTCCCCAAGATGTCATCCTCAAATTCCGGGACAAGATTGAGAAAATGGA
GAAAGATGTGTATGCAGTTCTGCAGCTAGAGGCGGAGGAAAAAGAGATGCAGCAGTCAGAAGCCCAGATC
AATACAGCAAAGCGGCTCCTGGAGAAGGGGAAGGAGGCAGTGGTCCAAGAGCCCGAGAGGAGCTGGTTCC
AGACCAAAGAAGAGAGGAAGAAGGAGAAAATTGCCAAAGCTCTGCAGGAATTTGACTTGGCCTTAAGAGG
AAAGAAGAAAAGGAAGAAGTTTATGAAGGATGCCAAAAAAAAGGGGGAGATGACAGCAGAGGAAAGGTCT
CAGTTTGAAATCCTCAAGGCGCAGATGTTTGCTGAACGGCTAGCGAAGAGGAATCGCAGAGCCAAGCGGG
CCCGAGCAATGCCCGAGGAGGAGCCAGTGAGAGGTCCTGCCAAGAAGCAAAAGCAGGGGAAGAAATCTGT
ATTTGATGAAGAACTCACCAACACAAGCAAGAAGGCCCTGAAACAGTATCGAGCTGGCCCTTCCTTTGAA
GAAAGGAAACAGTTGGGCTTGCCCCACCAGAGACGAGGAGGAAACTTTAAATCTAAATCCAGATACAAGA
GGAGGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219725 representing NM_017895
Red=Cloning site Green=Tags(s)

MVLAQRRRGGCEKLRAGPQAVLASGSGFCDNMLADLGLIGTIGEDDEVPVEPESDSGDEEEEGPIVLGRR
QKALGKNRSADFNPDFVFTEKEGTYDGSWALADVMSQLKKKRAATTLDEKIEKVRKKRKTEDKEAKSGKL
EKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGGFFED
ASQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERL
IYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGLDVKSQEAALRAAPDILIATPGRL
IDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNP
VRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLTRTFTDHVMLFTQTKKQAHRMHILLGLMGLQV
GELHGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRA
GRSVSLVGEDERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQQSEAQI
NTAKRLLEKGKEAVVQEPERSWFQTKEERKKEKIAKALQEFDLALRGKKKRKKFMKDAKKKGEMTAEERS
QFEILKAQMFAERLAKRNRRAKRARAMPEEEPVRGPAKKQKQGKKSVFDEELTNTSKKALKQYRAGPSFE
ERKQLGLPHQRRGGNFKSKSRYKRRK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017895
ORF Size 2388 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017895.6, NM_017895.7, NP_060365
RefSeq Size 2657
RefSeq ORF 2391
Locus ID 55661
Cytogenetics 20q13.13
Domains DEAD, helicase_C
MW 89.7 kDa
Gene Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein involved in the processing of 5.8S and 28S ribosomal RNAs. More specifically, the encoded protein localizes to the nucleolus, where it interacts with the PeBoW complex to ensure proper 3' end formation of 47S rRNA. [provided by RefSeq, Jan 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations