CEBP Alpha(CEBPA) (NM_004364) Human Tagged ORF Clone

CAT#: RC218955

CEBPA (Myc-DDK-tagged)-Human CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA)

Need custom modification / cloning service?
Get a free quote

USD 454.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CEBP Alpha(CEBPA) (NM_004364) Human Tagged ORF Clone
Symbol CEBPA
Synonyms C/EBP-alpha; CEBP
Vector pCMV6-Entry
Sequence Data
>RC218955 representing NM_004364
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTCGGCCGACTTCTACGAGGCGGAGCCGCGGCCCCCGATGAGCAGCCACCTGCAGAGCCCCCCGC
ACGCGCCCAGCAGCGCCGCCTTCGGCTTTCCCCGGGGCGCGGGCCCCGCGCAGCCTCCCGCCCCACCTGC
CGCCCCGGAGCCGCTGGGCGGCATCTGCGAGCACGAGACGTCCATCGACATCAGCGCCTACATCGACCCG
GCCGCCTTCAACGACGAGTTCCTGGCCGACCTGTTCCAGCACAGCCGGCAGCAGGAGAAGGCCAAGGCGG
CCGTGGGCCCCACGGGCGGCGGCGGCGGCGGCGACTTTGACTACCCGGGCGCGCCCGCGGGCCCCGGCGG
CGCCGTCATGCCCGGGGGAGCGCACGGGCCCCCGCCCGGCTACGGCTGCGCGGCCGCCGGCTACCTGGAC
GGCAGGCTGGAGCCCCTGTACGAGCGCGTCGGGGCGCCGGCGCTGCGGCCGCTGGTGATCAAGCAGGAGC
CCCGCGAGGAGGATGAAGCCAAGCAGCTGGCGCTGGCCGGCCTCTTCCCTTACCAGCCGCCGCCGCCGCC
GCCGCCCTCGCACCCGCACCCGCACCCGCCGCCCGCGCACCTGGCCGCCCCGCACCTGCAGTTCCAGATC
GCGCACTGCGGCCAGACCACCATGCACCTGCAGCCCGGTCACCCCACGCCGCCGCCCACGCCCGTGCCCA
GCCCGCACCCCGCGCCCGCGCTCGGTGCCGCCGGCCTGCCGGGCCCTGGCAGCGCGCTCAAGGGGCTGGG
CGCCGCGCACCCCGACCTCCGCGCGAGTGGCGGCAGCGGCGCGGGCAAGGCCAAGAAGTCGGTGGACAAG
AACAGCAACGAGTACCGGGTGCGGCGCGAGCGCAACAACATCGCGGTGCGCAAGAGCCGCGACAAGGCCA
AGCAGCGCAACGTGGAGACGCAGCAGAAGGTGCTGGAGCTGACCAGTGACAATGACCGCCTGCGCAAGCG
GGTGGAACAGCTGAGCCGCGAACTGGACACGCTGCGGGGCATCTTCCGCCAGCTGCCAGAGAGCTCCTTG
GTCAAGGCCATGGGCAACTGCGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218955 representing NM_004364
Red=Cloning site Green=Tags(s)

MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDP
AAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLD
GRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQI
AHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDK
NSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSL
VKAMGNCA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004364
ORF Size 1074 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004364.1, NM_004364.2, NM_004364.3, NM_004364.4, NP_004355
RefSeq Size 2385
RefSeq ORF 1077
Locus ID 1050
Cytogenetics 19q13.11
Protein Families ES Cell Differentiation/IPS, Druggable Genome
Protein Pathways Pathways in cancer, Acute myeloid leukemia
MW 37.4 kDa
Gene Summary This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons. [provided by RefSeq, Dec 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)