KCNQ3 (NM_004519) Human Tagged ORF Clone

CAT#: RC218739

Reviews ()
Write a review

KCNQ3 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 3 (KCNQ3), transcript variant 1



  "NM_004519" in other vectors (6)

Reconstitution Protocol

USD 798.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "KCNQ3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNQ3
Synonyms BFNC2; EBN2; KV7.3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218739 representing NM_004519
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTCAAGGCGCGCAGGGCGGCGGGGGCGGCTGGCGGCGGCGGCGACGGGGGCGGCGGAGGCGGCG
GGGCGGCTAACCCAGCCGGAGGGGACGCGGCGGCGGCCGGCGACGAGGAGCGGAAAGTGGGGCTGGCGCC
CGGCGACGTGGAGCAAGTCACCTTGGCGCTCGGGGCCGGAGCCGACAAAGACGGGACCCTGCTGCTGGAG
GGCGGCGGCCGCGACGAGGGGCAGCGGAGGACCCCGCAGGGCATCGGGCTCCTGGCCAAGACCCCGCTGA
GCCGCCCAGTCAAGAGAAACAACGCCAAGTACCGGCGCATCCAAACTTTGATCTACGACGCCCTGGAGAG
ACCGCGGGGCTGGGCGCTGCTTTACCACGCGTTGGTGTTCCTGATTGTCCTGGGGTGCTTGATTCTGGCT
GTCCTGACCACATTCAAGGAGTATGAGACTGTCTCGGGAGACTGGCTTCTGTTACTGGAGACATTTGCTA
TTTTCATCTTTGGAGCCGAGTTTGCTTTGAGGATCTGGGCTGCTGGATGTTGCTGCCGATACAAAGGCTG
GCGGGGCCGACTGAAGTTTGCCAGGAAGCCCCTGTGCATGTTGGACATCTTTGTGCTGATTGCCTCTGTG
CCAGTGGTTGCTGTGGGAAACCAAGGCAATGTTCTGGCCACCTCCCTGCGAAGCCTGCGCTTCCTGCAGA
TCCTGCGCATGCTGCGGATGGACCGGAGAGGTGGCACCTGGAAGCTTCTGGGCTCAGCCATCTGTGCCCA
CAGCAAAGAACTCATCACGGCCTGGTACATCGGTTTCCTGACACTCATCCTTTCTTCATTTCTTGTCTAC
CTGGTTGAGAAAGACGTCCCAGAGGTGGATGCACAAGGAGAGGAGATGAAAGAGGAGTTTGAGACCTATG
CAGATGCCCTGTGGTGGGGCCTGATCACACTGGCCACCATTGGCTATGGAGACAAGACACCCAAAACGTG
GGAAGGCCGTCTGATTGCCGCCACCTTTTCCTTAATTGGCGTCTCCTTTTTTGCCCTTCCAGCGGGCATC
CTGGGGTCCGGGCTGGCCCTCAAGGTGCAGGAGCAACACCGTCAGAAGCACTTTGAGAAAAGGAGGAAGC
CAGCTGCTGAGCTCATTCAGGCTGCCTGGAGGTATTATGCTACCAACCCCAACAGGATTGACCTGGTGGC
GACATGGAGATTTTATGAATCAGTCGTCTCTTTTCCTTTCTTCAGGAAAGAACAGCTGGAGGCAGCATCC
AGCCAAAAGCTGGGTCTCTTGGATCGGGTTCGCCTTTCTAATCCTCGTGGTAGCAATACTAAAGGAAAGC
TATTTACCCCTCTGAATGTAGATGCCATAGAAGAAAGTCCTTCTAAAGAACCAAAGCCTGTTGGCTTAAA
CAATAAAGAGCGTTTCCGCACGGCCTTCCGCATGAAAGCCTACGCTTTCTGGCAGAGTTCTGAAGATGCC
GGGACAGGTGACCCCATGGCGGAAGACAGGGGCTATGGGAATGACTTCCCCATCGAAGACATGATCCCCA
CCCTGAAGGCCGCCATCCGAGCCGTCAGAATTCTACAATTCCGTCTCTATAAAAAAAAATTCAAGGAGAC
TTTGAGGCCTTACGATGTGAAGGATGTGATTGAGCAGTATTCTGCCGGGCATCTCGACATGCTTTCCAGG
ATAAAGTACCTTCAGACGAGAATAGATATGATTTTCACCCCTGGACCTCCCTCCACGCCAAAACACAAGA
AGTCTCAGAAAGGGTCAGCATTCACCTTCCCATCCCAGCAATCTCCCAGGAATGAACCATATGTAGCCAG
ACCATCCACATCAGAAATCGAAGACCAAAGCATGATGGGGAAGTTTGTAAAAGTTGAAAGACAGGTTCAG
GACATGGGGAAGAAGCTGGACTTCCTCGTGGATATGCACATGCAACACATGGAACGGTTGCAGGTGCAGG
TCACGGAGTATTACCCAACCAAGGGCACCTCCTCGCCAGCTGAAGCAGAGAAGAAGGAGGACAACAGGTA
TTCCGATTTGAAAACCATCATCTGCAACTATTCTGAGACAGGCCCCCCGGAACCACCCTACAGCTTCCAC
CAGGTGACCATTGACAAAGTCAGCCCCTATGGGTTTTTTGCACATGACCCTGTGAACCTGCCCCGAGGGG
GACCCAGTTCTGGAAAGGTTCAGGCAACTCCTCCTTCCTCAGCAACAACGTATGTGGAGAGGCCCACGGT
CCTGCCTATCTTGACTCTTCTCGACTCCCGAGTGAGCTGCCACTCCCAGGCTGACCTGCAGGGCCCCTAC
TCGGACCGAATCTCCCCCCGGCAGAGACGTAGCATCACGCGAGACAGTGACACACCTCTGTCCCTGATGT
CGGTCAACCACGAGGAGCTGGAGAGGTCTCCAAGTGGCTTCAGCATCTCCCAGGACAGAGATGATTATGT
GTTCGGCCCCAATGGGGGGTCGAGCTGGATGAGGGAGAAGCGGTACCTCGCCGAGGGTGAGACGGACACA
GACACGGACCCCTTCACGCCCAGCGGCTCCATGCCTCTGTCGTCCACAGGGGATGGGATTTCTGATTCAG
TATGGACCCCTTCCAATAAGCCCATT


CTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGATGACGACG
ATAA
GGTTTAA
>RC218739 representing NM_004519
Red=Cloning site Green=Tags(s)

MGLKARRAAGAAGGGGDGGGGGGGAANPAGGDAAAAGDEERKVGLAPGDVEQVTLALGAGADKDGTLLLE
GGGRDEGQRRTPQGIGLLAKTPLSRPVKRNNAKYRRIQTLIYDALERPRGWALLYHALVFLIVLGCLILA
VLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRGRLKFARKPLCMLDIFVLIASV
PVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVY
LVEKDVPEVDAQGEEMKEEFETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGI
LGSGLALKVQEQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAAS
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEDA
GTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQYSAGHLDMLSR
IKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPRNEPYVARPSTSEIEDQSMMGKFVKVERQVQ
DMGKKLDFLVDMHMQHMERLQVQVTEYYPTKGTSSPAEAEKKEDNRYSDLKTIICNYSETGPPEPPYSFH
QVTIDKVSPYGFFAHDPVNLPRGGPSSGKVQATPPSSATTYVERPTVLPILTLLDSRVSCHSQADLQGPY
SDRISPRQRRSITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDT
DTDPFTPSGSMPLSSTGDGISDSVWTPSNKPI

LEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-XhoI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004519
ORF Size 2616 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004519.4
RefSeq Size 3097 bp
RefSeq ORF 2619 bp
Locus ID 3786
UniProt ID O43525
Cytogenetics 8q24.22
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 96.6 kDa
Gene Summary This gene encodes a protein that functions in the regulation of neuronal excitability. The encoded protein forms an M-channel by associating with the products of the related KCNQ2 or KCNQ5 genes, which both encode integral membrane proteins. M-channel currents are inhibited by M1 muscarinic acetylcholine receptors and are activated by retigabine, a novel anti-convulsant drug. Defects in this gene are a cause of benign familial neonatal convulsions type 2 (BFNC2), also known as epilepsy, benign neonatal type 2 (EBN2). Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2014]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.