KCNQ3 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 3 (KCNQ3)
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "KCNQ3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse, Hamster |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 97 kDa |
Gene Name | potassium voltage-gated channel subfamily Q member 3 |
Database Link | |
Background | Probably important in the regulation of neuronal excitability. Associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. |
Synonyms | BFNC2; EBN2; KV7.3 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.