CD59 (NM_000611) Human Tagged ORF Clone
CAT#: RC218343
CD59 (Myc-DDK-tagged)-Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2
Specifications
Product Data | |
Product Name | CD59 (NM_000611) Human Tagged ORF Clone |
Symbol | CD59 |
Synonyms | 16.3A5; 1F5; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; |
Vector | pCMV6-Entry |
Sequence Data |
>RC218343 representing NM_000611
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGAATCCAAGGAGGGTCTGTCCTGTTCGGGCTGCTGCTCGTCCTGGCTGTCTTCTGCCATTCAGGTC ATAGCCTGCAGTGCTACAACTGTCCTAACCCAACTGCTGACTGCAAAACAGCCGTCAATTGTTCATCTGA TTTTGATGCGTGTCTCATTACCAAAGCTGGGTTACAAGTGTATAACAAGTGTTGGAAGTTTGAGCATTGC AATTTCAACGACGTCACAACCCGCTTGAGGGAAAATGAGCTAACGTACTACTGCTGCAAGAAGGACCTGT GTAACTTTAACGAACAGCTTGAAAATGGTGGGACATCCTTATCAGAGAAAACAGTTCTTCTGCTGGTGAC TCCATTTCTGGCAGCAGCCTGGAGCCTTCATCCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC218343 representing NM_000611
Red=Cloning site Green=Tags(s) MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
Tag | Myc-DDK |
ACCN | NM_000611 |
ORF Size | 384 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reference Data | |
RefSeq | NM_000611.1, NM_000611.2, NM_000611.3, NM_000611.4, NM_000611.5, NP_000602 |
RefSeq Size | 7633 |
RefSeq ORF | 387 |
Locus ID | 966 |
Cytogenetics | 11p13 |
Domains | LU |
Protein Families | Druggable Genome |
Protein Pathways | Complement and coagulation cascades, Hematopoietic cell lineage |
MW | 14.18 kDa |
Gene Summary | This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]. |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Increased internalization of complement inhibitor CD59 may contribute to endothelial inflammation in obstructive sleep apnea
,Emin, M;Wang, G;Castagna, F;Rodriguez-Lopez, J;Wahab, R;Wang, J;Adams, T;Wei, Y;Jelic, S;,
Sci Transl Med Jan 2016
,PubMed ID 26738794
[CD59]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
cDNA Clone Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC218343L2 | Lenti ORF clone of Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2, mGFP tagged |
USD 680.00 |
|
RC218343L2V | Lenti ORF particles, CD59 (mGFP-tagged) - Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2, 200ul, >10^7 TU/mL |
USD 930.00 |
|
RC218343L1V | Lenti ORF particles, CD59 (Myc-DDK tagged) - Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2 , 200ul, >10^7 TU/mL |
USD 830.00 |
|
SC119785 | CD59 (untagged)-Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2 |
USD 300.00 |
|
RC218343L4V | Lenti ORF particles, CD59 (mGFP-tagged) - Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2, 200ul, >10^7 TU/mL |
USD 930.00 |
|
RC218343L3V | Lenti ORF particles, CD59 (Myc-DDK tagged) - Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2 , 200ul, >10^7 TU/mL |
USD 830.00 |
|
RC218343L4 | Lenti ORF clone of Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2, mGFP tagged |
USD 680.00 |
|
RG218343 | CD59 (GFP-tagged) - Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2 |
USD 460.00 |
|
RC218343L3 | Lenti ORF clone of Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2 , Myc-DDK-tagged |
USD 620.00 |
|
RC218343L1 | Lenti ORF clone of Human CD59 molecule, complement regulatory protein (CD59), transcript variant 2 , Myc-DDK-tagged |
USD 620.00 |
USD 299.00
USD 550.00