CARD14 (NM_024110) Human Tagged ORF Clone

CAT#: RC217455

Reviews ()
Write a review

CARD14 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 14 (CARD14), transcript variant 1



Reconstitution Protocol

USD 874.00

In Stock*

Size
    • 10 ug

Product images

Other products for "CARD14"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CARD14
Synonyms BIMP2; CARMA2; PRP; PSORS2; PSS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217455 representing NM_024110
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGAACTGTGCCGCAGGGACTCCGCACTCACGGCACTGGACGAGGAGACACTGTGGGAGATGATGG
AGAGCCACCGCCACAGGATCGTACGCTGCATCTGCCCCAGCCGCCTCACCCCCTACCTGCGCCAGGCCAA
GGTGCTGTGCCAGCTGGACGAGGAGGAGGTGCTGCACAGCCCCCGGCTCACCAACAGCGCCATGCGGGCC
GGGCACTTGCTGGATTTGCTGAAGACTCGAGGGAAGAACGGGGCCATCGCCTTCCTGGAGAGCCTGAAGT
TCCACAACCCTGACGTCTACACCCTGGTCACCGGGCTGCAGCCTGATGTTGACTTCAGTAACTTTAGCGG
TCTCATGGAGACATCCAAGCTGACCGAGTGCCTGGCTGGGGCCATCGGCAGCCTGCAGGAGGAGCTGAAC
CAGGAAAAGGGGCAGAAGGAGGTGCTGCTGCGGCGGTGCCAGCAGCTGCAGGAGCACCTGGGCCTGGCCG
AGACCCGTGCCGAGGGCCTGCACCAGCTGGAGGCTGACCACAGCCGCATGAAGCGTGAGGTTAGCGCACA
CTTCCATGAGGTGCTGAGGCTGAAGGACGAGATGCTCAGCCTCTCGCTGCACTATAGCAATGCGCTGCAG
GAAAAGGAGCTGGCCGCCTCACGCTGCCGCAGCCTGCAGGAGGAGCTGTATCTACTGAAGCAGGAGCTGC
AGCGAGCCAACATGGTTTCCTCCTGTGAGCTGGAATTGCAAGAGCAGTCCCTGAGGACAGCCAGCGACCA
GGAGTCCGGGGATGAGGAGCTGAACCGCCTGAAGGAGGAGAATGAGAAACTGCGCTCGCTGACTTTCAGC
CTGGCGGAGAAGGACATTCTGGAGCAGAGCCTGGACGAGGCGCGGGGGAGCCGACAGGAGCTGGTGGAGC
GCATCCACTCGCTGCGGGAGCGGGCCGTGGCTGCCGAGAGGCAGCGAGAGCAGTACTGGGAAGAGAAGGA
ACAGACCCTGCTGCAGTTCCAGAAGAGTAAGATGGCCTGCCAACTCTACAGGGAGAAGGTGAATGCGCTG
CAGGCCCAGGTGTGCGAGCTGCAGAAGGAGCGAGACCAGGCGTACTCCGCGAGGGACAGTGCTCAGAGGG
AGATTTCCCAGAGCCTGGTGGAGAAGGACTCCCTCCGCAGGCAGGTGTTCGAGCTGACGGACCAGGTCTG
CGAGCTGCGCACACAGCTTCGCCAGCTGCAGGCAGAGCCTCCGGGTGTGCTCAAGCAGGAAGCCAGGACC
AGGGAGCCCTGTCCACGGGAGAAGCAGCGGCTGGTGCGGATGCATGCCATCTGCCCCAGAGACGACAGCG
ACTGCAGCCTCGTCAGCTCCACAGAGTCTCAGCTCTTGTCGGACCTGAGTGCCACGTCCAGCCGCGAGCT
GGTGGACAGCTTCCGCTCCAGCAGCCCCGCGCCCCCCAGCCAGCAGTCCCTGTACAAGCGGGTGGCCGAG
GACTTCGGGGAAGAACCCTGGTCTTTCAGCAGCTGCCTGGAGATCCCGGAGGGAGACCCGGGAGCCCTGC
CGGGAGCTAAGGCAGGCGACCCACACCTGGATTATGAGCTCCTAGACACGGCAGACCTTCCGCAGCTGGA
AAGCAGCCTGCAGCCAGTCTCCCCTGGAAGGCTTGATGTCTCGGAGAGCGGCGTCCTCATGCGGCGGAGG
CCAGCCCGCAGGATCCTGAGCCAGGTCACCATGCTGGCGTTCCAGGGGGATGCATTGCTGGAGCAGATCA
GCGTCATCGGCGGGAACCTCACGGGCATCTTCATCCACCGGGTCACCCCGGGCTCGGCGGCGGACCAGAT
GGCCTTGCGCCCGGGCACCCAGATTGTGATGGTTGATTACGAAGCCTCAGAGCCCTTGTTCAAGGCAGTC
CTGGAGGACACGACCCTGGAGGAGGCCGTGGGGCTTCTCAGGAGGGTGGACGGCTTCTGCTGCCTGTCTG
TGAAGGTCAACACGGACGGTTATAAGAGGCTACTCCAGGACCTGGAGGCCAAAGTGGCGACCTCGGGGGA
CTCATTCTACATCCGGGTCAACCTGGCCATGGAGGGCAGGGCCAAAGGGGAGCTGCAGGTGCATTGCAAC
GAGGTCCTGCACGTCACCGACACCATGTTCCAGGGCTGCGGCTGCTGGCATGCCCACCGCGTGAACTCTT
ACACCATGAAGGATACTGCCGCGCACGGCACCATCCCCAACTACTCCAGGGCTCAGCAGCAGCTCATAGC
CCTCATCCAGGACATGACTCAGCAGTGCACCGTGACCCGCAAGCCATCTTCTGGGGGACCACAGAAGCTG
GTCCGCATCGTCAGTATGGACAAAGCCAAGGCCAGCCCTCTGCGTTTGTCCTTTGACAGGGGCCAGTTGG
ACCCCAGCAGGATGGAGGGCTCCAGCACGTGCTTCTGGGCCGAGAGCTGCCTCACCCTGGTGCCCTATAC
CCTGGTGTGGCCCCATCGACCCGCCCGGCCCCGGCCTGTGCTCCTCGTGCCCAGGGCGGTTGGGAAGATC
CTGAGCGAGAAACTGTGCCTCCTCCAAGGGTTTAAGAAGTGCCTGGCAGAGTACTTGAGCCAGGAGGAAT
ATGAGGCCTGGAGCCAGAGAGGGGACATCATCCAGGAGGGAGAGGTGTCCGGGGGCCGCTGCTGGGTGAC
CCGCCATGCTGTGGAGTCCCTCATGGAAAAGAACACCCATGCCCTCCTGGACGTCCAGCTGGACAGTGTC
TGCACCCTGCACAGGATGGACATCTTCCCCATCGTCATCCACGTCTCTGTCAACGAGAAGATGGCAAAGA
AGCTCAAGAAGGGCCTACAGCGGTTGGGCACCTCAGAGGAGCAGCTCCTGGAGGCTGCGAGGCAGGAGGA
GGGAGACCTGGACCGGGCGCCCTGTCTATACAGCAGCCTGGCTCCTGACGGCTGGAGCGACCTGGACGGC
CTGCTCAGCTGTGTCCGCCAGGCCATCGCCGACGAGCAGAAGAAGGTGGTGTGGACGGAGCAGAGCCCCC
GA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217455 representing NM_024110
Red=Cloning site Green=Tags(s)

MGELCRRDSALTALDEETLWEMMESHRHRIVRCICPSRLTPYLRQAKVLCQLDEEEVLHSPRLTNSAMRA
GHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLMETSKLTECLAGAIGSLQEELN
QEKGQKEVLLRRCQQLQEHLGLAETRAEGLHQLEADHSRMKREVSAHFHEVLRLKDEMLSLSLHYSNALQ
EKELAASRCRSLQEELYLLKQELQRANMVSSCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFS
LAEKDILEQSLDEARGSRQELVERIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNAL
QAQVCELQKERDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELRTQLRQLQAEPPGVLKQEART
REPCPREKQRLVRMHAICPRDDSDCSLVSSTESQLLSDLSATSSRELVDSFRSSSPAPPSQQSLYKRVAE
DFGEEPWSFSSCLEIPEGDPGALPGAKAGDPHLDYELLDTADLPQLESSLQPVSPGRLDVSESGVLMRRR
PARRILSQVTMLAFQGDALLEQISVIGGNLTGIFIHRVTPGSAADQMALRPGTQIVMVDYEASEPLFKAV
LEDTTLEEAVGLLRRVDGFCCLSVKVNTDGYKRLLQDLEAKVATSGDSFYIRVNLAMEGRAKGELQVHCN
EVLHVTDTMFQGCGCWHAHRVNSYTMKDTAAHGTIPNYSRAQQQLIALIQDMTQQCTVTRKPSSGGPQKL
VRIVSMDKAKASPLRLSFDRGQLDPSRMEGSSTCFWAESCLTLVPYTLVWPHRPARPRPVLLVPRAVGKI
LSEKLCLLQGFKKCLAEYLSQEEYEAWSQRGDIIQEGEVSGGRCWVTRHAVESLMEKNTHALLDVQLDSV
CTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDLDRAPCLYSSLAPDGWSDLDG
LLSCVRQAIADEQKKVVWTEQSPR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024110
ORF Size 3012 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024110.4
RefSeq Size 3917 bp
RefSeq ORF 3015 bp
Locus ID 79092
UniProt ID Q9BXL6
Cytogenetics 17q25.3
Protein Families Druggable Genome
MW 113.1 kDa
Gene Summary This gene encodes a caspase recruitment domain-containing protein that is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. Members of this protein family are scaffold proteins that are involved in a diverse array of cellular processes including cellular adhesion, signal transduction and cell polarity control. This protein has been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.