GJA3 (NM_021954) Human Tagged ORF Clone

CAT#: RC216756

  • TrueORF®

GJA3 (Myc-DDK-tagged)-Human gap junction protein, alpha 3, 46kDa (GJA3)

 Cited in 1 publication.

  View "NM_021954" in other vectors (10)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GJA3 (NM_021954) Human Tagged ORF Clone
Symbol GJA3
Synonyms CTRCT14; CX46; CZP3
Vector pCMV6-Entry
Sequence Data
>RC216756 representing NM_021954
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGACTGGAGCTTTCTGGGAAGACTCTTAGAAAATGCACAGGAGCACTCCACGGTCATCGGCAAGG
TTTGGCTGACCGTGCTGTTCATCTTCCGCATCTTGGTGCTGGGGGCCGCGGCGGAGGACGTGTGGGGCGA
TGAGCAGTCAGACTTCACCTGCAACACCCAGCAGCCGGGCTGCGAGAACGTCTGCTACGACAGGGCCTTC
CCCATCTCCCACATCCGCTTCTGGGCGCTGCAGATCATCTTCGTGTCCACGCCCACCCTCATCTACCTGG
GCCACGTGCTGCACATCGTGCGCATGGAAGAGAAGAAGAAAGAGAGGGAGGAGGAGGAGCAGCTGAAGAG
AGAGAGCCCCAGCCCCAAGGAGCCACCGCAGGACAATCCCTCGTCGCGGGACGACCGCGGCAGGGTGCGC
ATGGCCGGGGCGCTGCTGCGGACCTACGTCTTCAACATCATCTTCAAGACGCTGTTCGAGGTGGGCTTCA
TCGCCGGCCAGTACTTTCTGTACGGCTTCGAGCTGAAGCCGCTCTACCGCTGCGACCGCTGGCCCTGCCC
CAACACGGTGGACTGCTTCATCTCCAGGCCCACGGAGAAGACCATCTTCATCATCTTCATGCTGGCGGTG
GCCTGCGCGTCCCTGCTGCTCAACATGCTGGAGATCTACCACCTGGGCTGGAAGAAGCTCAAGCAGGGCG
TGACCAGCCGCCTCGGCCCGGACGCCTCCGAGGCCCCGCTGGGGACAGCCGATCCCCCGCCCCTGCCCCC
CAGCTCCCGGCCGCCCGCCGTTGCCATCGGGTTCCCACCCTACTATGCGCACACCGCTGCGCCCCTGGGA
CAGGCCCGCGCCGTGGGCTACCCCGGGGCCCCGCCACCAGCCGCGGACTTCAAAATGCTAGCCCTGACCG
AGGCGCGCGGAAAGGGCCAGTCCGCCAAGCTCTACAACGGCCACCACCACCTGCTGATGACTGAGCAGAA
CTGGGCCAACCAGGCGGCCGAGCGGCAGCCCCCGGCGCTCAAGGCTTACCCGGCAGCGTCCACGCCTGCA
GCCCCCAGCCCCGTCGGCAGCAGCTCCCCGCCACTCGCGCACGAGGCTGAGGCGGGCGCGGCGCCCCTGC
TGCTGGATGGGAGCGGCAGCAGTCTGGAGGGGAGCGCCCTGGCAGGGACCCCCGAGGAGGAGGAGCAGGC
CGTGACCACCGCGGCCCAGATGCACCAGCCGCCCTTGCCCCTCGGAGACCCAGGTCGGGCCAGCAAGGCC
AGCAGGGCCAGCAGCGGGCGGGCCAGACCGGAGGACTTGGCCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216756 representing NM_021954
Red=Cloning site Green=Tags(s)

MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQPGCENVCYDRAF
PISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVR
MAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFELKPLYRCDRWPCPNTVDCFISRPTEKTIFIIFMLAV
ACASLLLNMLEIYHLGWKKLKQGVTSRLGPDASEAPLGTADPPPLPPSSRPPAVAIGFPPYYAHTAAPLG
QARAVGYPGAPPPAADFKMLALTEARGKGQSAKLYNGHHHLLMTEQNWANQAAERQPPALKAYPAASTPA
APSPVGSSSPPLAHEAEAGAAPLLLDGSGSSLEGSALAGTPEEEEQAVTTAAQMHQPPLPLGDPGRASKA
SRASSGRARPEDLAI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021954
ORF Size 1305 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021954.1, NM_021954.2, NM_021954.3, NP_068773
RefSeq Size 1308
RefSeq ORF 1308
Locus ID 2700
Cytogenetics 13q12.11
Protein Families Ion Channels: Other, Transmembrane, Druggable Genome
MW 47.2 kDa
Gene Summary The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3). [provided by RefSeq, Jan 2010].

Citations (1)

Other Versions

Other products for "GJA3"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies