HIF1 beta (ARNT) (NM_001668) Human Tagged ORF Clone

CAT#: RC216724

Reviews ()
Write a review

ARNT (Myc-DDK-tagged)-Human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 1



Reconstitution Protocol

USD 722.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ARNT"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ARNT
Synonyms bHLHe2; HIF-1-beta; HIF-1beta; HIF1-beta; HIF1B; HIF1BETA; TANGO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216724 representing NM_001668
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGACTACTGCCAACCCCGAAATGACATCAGATGTACCATCACTGGGTCCAGCCATTGCCTCTG
GAAACTCTGGACCTGGAATTCAAGGTGGAGGAGCCATTGTCCAGAGGGCTATTAAGCGGCGACCAGGGCT
GGATTTTGATGATGATGGAGAAGGGAACAGTAAATTTTTGAGGTGTGATGATGATCAGATGTCTAACGAT
AAGGAGCGGTTTGCCAGGTCGGATGATGAGCAGAGCTCTGCGGATAAAGAGAGACTTGCCAGGGAAAATC
ACAGTGAAATTGAACGGCGGCGACGGAACAAGATGACAGCCTACATCACAGAACTGTCAGATATGGTACC
CACCTGTAGTGCCCTGGCTCGAAAACCAGACAAGCTAACCATCTTACGCATGGCAGTTTCTCACATGAAG
TCCTTGCGGGGAACTGGCAACACATCCACTGATGGCTCCTATAAGCCGTCTTTCCTCACTGATCAGGAAC
TGAAACATTTGATCTTGGAGGCAGCAGATGGCTTTCTGTTTATTGTCTCATGTGAGACAGGCAGGGTGGT
GTATGTGTCTGACTCCGTGACTCCTGTTTTGAACCAGCCACAGTCTGAATGGTTTGGCAGCACACTCTAT
GATCAGGTGCACCCAGATGATGTGGATAAACTTCGTGAGCAGCTTTCCACTTCAGAAAATGCCCTGACAG
GGCGTATCCTGGATCTAAAGACTGGAACAGTGAAAAAGGAAGGTCAGCAGTCTTCCATGAGAATGTGTAT
GGGCTCAAGGAGATCGTTTATTTGCCGAATGAGGTGTGGCAGTAGCTCTGTGGACCCAGTTTCTGTGAAT
AGGCTGAGCTTTGTGAGGAACAGATGCAGGAATGGACTTGGCTCTGTAAAGGATGGGGAACCTCACTTCG
TGGTGGTCCACTGCACAGGCTACATCAAGGCCTGGCCCCCAGCAGGTGTTTCCCTCCCAGATGATGACCC
AGAGGCTGGCCAGGGAAGCAAGTTTTGCCTAGTGGCCATTGGCAGATTGCAGGTAACTAGTTCTCCCAAC
TGTACAGACATGAGTAATGTTTGTCAACCAACAGAGTTCATCTCCCGACACAACATTGAGGGTATCTTCA
CTTTTGTGGATCACCGCTGTGTGGCTACTGTTGGCTACCAGCCACAGGAACTCTTAGGAAAGAATATTGT
AGAATTCTGTCATCCTGAAGACCAGCAGCTTCTAAGAGACAGCTTCCAACAGGTAGTGAAATTAAAAGGC
CAAGTGCTGTCTGTCATGTTCCGGTTCCGGTCTAAGAACCAAGAATGGCTCTGGATGAGAACCAGCTCCT
TTACTTTCCAGAACCCTTACTCAGATGAAATTGAGTACATCATCTGTACCAACACCAATGTGAAGAACTC
TAGCCAAGAACCACGGCCTACACTCTCCAACACAATCCAGAGGCCACAACTAGGTCCCACAGCTAATTTA
CCCCTGGAGATGGGCTCAGGACAGCTGGCACCCAGGCAGCAGCAACAGCAAACAGAATTGGACATGGTAC
CAGGAAGAGATGGACTGGCCAGCTACAATCATTCCCAGGTGGTTCAGCCTGTGACAACCACAGGACCAGA
ACACAGCAAGCCCCTTGAGAAGTCAGATGGTTTATTTGCCCAGGATAGAGATCCAAGATTTTCAGAAATC
TATCACAACATCAATGCGGATCAGAGTAAAGGCATCTCCTCCAGCACTGTCCCTGCCACCCAACAGCTAT
TCTCCCAGGGCAACACATTCCCTCCTACCCCCCGGCCGGCAGAGAATTTCAGGAATAGTGGCCTAGCCCC
TCCTGTAACCATTGTCCAGCCATCAGCTTCTGCAGGACAGATGTTGGCCCAGATTTCCCGCCACTCCAAC
CCCACCCAAGGAGCAACCCCAACTTGGACCCCTACTACCCGCTCAGGCTTTTCTGCCCAGCAGGTGGCTA
CCCAGGCTACTGCTAAGACTCGTACTTCCCAGTTTGGTGTGGGCAGCTTTCAGACTCCATCCTCCTTCAG
CTCCATGTCCCTCCCTGGTGCCCCAACTGCATCGCCTGGTGCTGCTGCCTACCCTAGTCTCACCAATCGT
GGATCTAACTTTGCTCCTGAGACTGGACAGACTGCAGGACAATTCCAGACACGGACAGCAGAGGGTGTGG
GTGTCTGGCCACAGTGGCAGGGCCAGCAGCCTCATCATCGTTCAAGTTCTAGTGAGCAACATGTTCAACA
ACCGCCAGCACAGCAACCTGGCCAGCCTGAGGTCTTCCAGGAGATGCTGTCCATGCTGGGAGATCAGAGC
AACAGCTACAACAATGAAGAATTCCCTGATCTAACTATGTTTCCCCCCTTTTCAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216724 representing NM_001668
Red=Cloning site Green=Tags(s)

MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND
KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK
SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY
DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN
RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN
CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANL
PLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEI
YHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSN
PTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR
GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQS
NSYNNEEFPDLTMFPPFSE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001668
ORF Size 2367 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001668.4
RefSeq Size 4846 bp
RefSeq ORF 2370 bp
Locus ID 405
UniProt ID P27540
Cytogenetics 1q21.3
Domains PAS, HLH, PAC
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Renal cell carcinoma
MW 86.5 kDa
Gene Summary This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.