NEDL2 (HECW2) (NM_020760) Human Tagged ORF Clone

CAT#: RC216544

Reviews ()
Write a review

HECW2 (Myc-DDK-tagged)-Human HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2 (HECW2)



Reconstitution Protocol

USD 2,017.00

In Stock*

Size
    • 10 ug

Product images

Other products for "HECW2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HECW2
Synonyms NDHSAL; NEDL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216544 representing NM_020760
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAGTTCAGCCCGGGAGCACCTGCTTTTTGTGAGGCGTCGAAATCCCCAGATGCGGTACACATTGA
GCCCAGAGAACCTCCAGAGCCTTGCCGCCCAGAGCTCCATGCCAGAGAACATGACCCTGCAGCGGGCCAA
CAGCGACACCGACCTGGTGACTTCTGAGAGCCGCTCCAGCTTAACTGCCAGCATGTACGAGTACACGCTG
GGGCAAGCCCAGAACCTCATTATCTTCTGGGACATTAAAGAGGAGGTGGACCCCAGTGATTGGATTGGAC
TTTATCATATAGATGAGAATTCTCCAGCCAACTTCTGGGATTCTAAGAACAGGGGTGTGACTGGAACACA
AAAAGGGCAAATTGTATGGAGAATTGAGCCTGGACCCTATTTCATGGAACCGGAGATAAAAATCTGTTTT
AAATATTACCACGGCATTAGTGGAGCCCTGCGAGCCACGACCCCCTGCATCACCGTGAAGAACCCAGCTG
TGATGATGGGGGCAGAAGGCATGGAGGGAGGTGCTTCAGGAAACCTGCATTCTCGAAAACTTGTTAGCTT
TACATTGTCAGATCTTAGGGCAGTTGGGCTAAAGAAAGGGATGTTCTTCAATCCTGACCCTTATCTTAAG
ATGTCAATTCAGCCAGGAAAGAAGAGCAGTTTCCCCACCTGTGCCCACCACGGGCAGGAGAGACGGTCTA
CTATCATCAGTAACACCACCAATCCAATTTGGCACCGAGAGAAATATTCCTTTTTTGCACTTCTTACTGA
TGTCTTAGAAATTGAAATTAAAGACAAATTTGCCAAGAGCCGTCCCATCATCAAGCGTTTTCTGGGGAAA
CTAACCATTCCAGTCCAGAGGCTGCTGGAGCGACAAGCCATCGGTGATCAAATGCTCAGCTACAACCTTG
GCAGAAGGCTCCCAGCTGACCACGTGAGTGGGTACCTCCAGTTTAAAGTGGAGGTTACGTCTTCTGTTCA
TGAAGATGCCTCTCCAGAAGCTGTTGGCACAATACTTGGAGTCAATTCTGTGAATGGAGACTTAGGTAGC
CCTTCCGATGACGAGGACATGCCAGGGAGCCATCACGACAGCCAGGTGTGCTCTAATGGGCCAGTTTCTG
AGGACAGTGCTGCCGATGGAACCCCCAAGCATTCATTCAGGACTAGCTCCACTCTGGAAATAGACACAGA
GGAATTAACCTCTACGTCTTCAAGGACCTCACCTCCCAGAGGACGTCAGGATTCACTCAATGATTACTTA
GATGCTATCGAACACAATGGCCACTCCAGGCCAGGGACAGCGACCTGCTCTGAGAGGTCCATGGGTGCCT
CTCCGAAACTGAGGAGTAGTTTTCCCACTGACACAAGACTCAATGCCATGCTTCATATTGATTCAGATGA
AGAAGATCACGAGTTCCAGCAAGACCTGGGTTACCCATCTTCCTTGGAGGAGGAGGGAGGCCTGATCATG
TTTAGCAGGGCATCCAGAGCTGATGATGGAAGCCTGACATCTCAGACAAAGCTGGAGGACAACCCTGTTG
AGAATGAGGAAGCCTCCACACACGAAGCTGCTTCCTTTGAGGATAAGCCAGAAAATCTTCCAGAGCTTGC
AGAGAGCTCCTTACCTGCAGGCCCAGCCCCAGAGGAAGGTGAAGGCGGCCCAGAGCCTCAACCCAGTGCT
GACCAGGGCAGTGCTGAACTGTGTGGCTCTCAAGAGGTAGATCAGCCCACAAGTGGCGCAGACACAGGGA
CTTCCGATGCATCAGGAGGAAGCCGAAGAGCCGTCAGTGAGACCGAGTCTCTCGATCAGGGCTCTGAGCC
TTCCCAGGTGTCCTCTGAAACAGAACCCAGTGATCCTGCCAGGACAGAGAGTGTGAGCGAAGCCAGCACC
AGGCCTGAGGGAGAGAGTGACCTGGAATGCGCTGACAGCTCCTGCAATGAGAGTGTGACCACGCAGCTGT
CCTCTGTGGACACACGGTGCTCCTCTCTTGAGAGCGCACGGTTTCCTGAAACCCCAGCCTTTTCTTCTCA
GGAGGAGGAAGACGGAGCCTGTGCAGCAGAGCCCACCAGCAGTGGCCCTGCCGAAGGGTCGCAGGAATCC
GTGTGCACTGCTGGTTCTTTACCTGTGGTACAGGTGCCCAGTGGGGAGGATGAAGGGCCAGGGGCAGAAT
CGGCCACTGTACCTGACCAGGAGGAGCTGGGGGAGGTCTGGCAGCGGAGGGGGAGCCTGGAGGGAGCTGC
AGCTGCTGCCGAGAGCCCACCGCAAGAAGAAGGCAGTGCTGGGGAGGCCCAAGGCACCTGTGAAGGGGCA
ACTGCCCAGGAGGAGGGCGCTACTGGAGGTTCTCAAGCCAACGGCCACCAGCCACTGCGATCACTACCTT
CAGTGCGCCAGGATGTTAGCCGGTACCAGAGGGTGGACGAGGCTCTCCCACCAAACTGGGAGGCACGCAT
TGACAGCCACGGCAGGATCTTCTACGTGGATCACGTAAACAGAACCACGACGTGGCAGCGACCGACAGCT
CCCCCAGCCCCGCAGGTGCTGCAGAGATCTAACTCCATACAGCAAATGGAGCAGCTGAACCGGCGATATC
AGAGTATCCGCAGAACCATGACCAATGAGAGGCCTGAGGAAAATACCAATGCTATTGATGGGGCAGGGGA
GGAAGCTGACTTTCACCAAGCCAGTGCAGATTTCCGACGGGAGAACATCCTGCCTCACTCTACCTCCAGA
TCCAGGATCACGTTGCTGTTACAGTCTCCCCCCGTGAAGTTCCTCATCAGCCCAGAGTTCTTCACCGTGC
TGCATTCTAACCCTAGTGCCTACCGCATGTTTACAAACAACACGTGTTTGAAGCACATGATCACCAAAGT
CCGGAGGGACACCCACCACTTTGAACGCTACCAGCATAACCGCGACCTTGTGGGATTCCTCAACATGTTC
GCGAACAAACAGCTAGAGCTGCCGCGGGGATGGGAAATGAAACATGATCACCAGGGCAAGGCATTCTTTG
TGGACCACAACTCCCGCACCACCACTTTCATTGATCCCCGGCTCCCACTTCAGAGCAGTAGACCCACAAG
TGCGCTGGTTCATCGGCAACACCTGACAAGGCAACGCAGCCACAGTGCGGGTGAGGTAGGAGAAGATTCT
CGACATGCAGGACCACCAGTTCTTCCCAGGCCATCCAGTACATTCAATACAGTCAGTAGGCCACAGTACC
AGGACATGGTTCCAGTGGCTTACAATGACAAGATTGTTGCATTTCTACGTCAACCCAATATCTTTGAAAT
TCTACAGGAGCGTCAACCTGATCTTACCAGGAATCACTCACTCAGGGAGAAGATCCAATTTATCCGAACT
GAAGGGACTCCAGGATTGGTGCGCCTTTCAAGCGATGCAGACCTTGTTATGTTGCTGAGCTTATTTGAAG
AAGAGATAATGTCATATGTGCCTCCACATGCCTTACTCCACCCCAGCTACTGTCAGTCCCCACGTGGCTC
TCCCGTGTCATCTCCTCAGAACTCGCCAGGTACCCAGCGTGCCAATGCCCGGGCTCCAGCCCCTTACAAG
CGGGATTTCGAAGCCAAACTGAGGAACTTTTACAGGAAGTTAGAGACTAAAGGATATGGACAAGGCCCAG
GGAAGTTAAAGTTAATTATCCGAAGAGATCACTTACTAGAAGATGCTTTTAATCAGATTATGGGCTACTC
CAGAAAAGACCTGCAGAGAAATAAGCTATATGTCACCTTCGTTGGGGAGGAAGGGCTGGATTACAGTGGG
CCTTCTAGAGAGTTTTTCTTCCTGGTATCCAGAGAACTCTTTAACCCATATTATGGCTTATTTGAATATT
CAGCCAATGACACATACACAGTACAAATAAGTCCTATGTCTGCTTTTGTAGACAATCACCATGAATGGTT
CCGATTCAGTGGTAGGATCCTTGGTCTTGCACTAATACACCAGTATTTGTTGGATGCCTTCTTCACACGG
CCCTTTTATAAGGCTCTTCTCAGAATTCTATGTGACCTGAGTGACCTAGAATACCTTGATGAAGAGTTCC
ATCAGAGCCTGCAGTGGATGAAAGACAATGATATCCATGACATCCTAGACCTCACGTTCACTGTGAACGA
AGAAGTATTTGGGCAGATAACTGAACGAGAATTAAAGCCAGGGGGTGCCAATATCCCAGTTACAGAGAAG
AACAAGAAGGAGTACATCGAGAGGATGGTGAAGTGGAGGATTGAGAGGGGTGTTGTACAGCAAACAGAGA
GCTTAGTGCGTGGCTTCTATGAGGTGGTGGATGCCAGGCTGGTATCTGTTTTTGATGCAAGAGAACTGGA
ATTGGTCATCGCAGGCACAGCTGAAATAGACCTAAGTGATTGGAGAAACAACACAGAATATAGAGGAGGA
TACCATGACAATCATATTGTAATTCGGTGGTTCTGGGCTGCAGTGGAAAGATTCAACAATGAACAACGAC
TAAGGTTGTTACAGTTTGTTACAGGCACATCCAGCATTCCCTATGAAGGATTTGCTTCACTCCGAGGGAG
TAACGGCCCAAGAAGATTCTGTGTGGAGAAATGGGGGAAAATCACTGCTCTTCCCAGAGCGCATACATGT
TTTAACCGTCTGGATCTGCCTCCCTACCCATCCTTTTCCATGCTTTATGAAAAACTGTTGACAGCAGTTG
AAGAAACCAGTACTTTTGGACTTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216544 representing NM_020760
Red=Cloning site Green=Tags(s)

MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQSSMPENMTLQRANSDTDLVTSESRSSLTASMYEYTL
GQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQIVWRIEPGPYFMEPEIKICF
KYYHGISGALRATTPCITVKNPAVMMGAEGMEGGASGNLHSRKLVSFTLSDLRAVGLKKGMFFNPDPYLK
MSIQPGKKSSFPTCAHHGQERRSTIISNTTNPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGK
LTIPVQRLLERQAIGDQMLSYNLGRRLPADHVSGYLQFKVEVTSSVHEDASPEAVGTILGVNSVNGDLGS
PSDDEDMPGSHHDSQVCSNGPVSEDSAADGTPKHSFRTSSTLEIDTEELTSTSSRTSPPRGRQDSLNDYL
DAIEHNGHSRPGTATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPSSLEEEGGLIM
FSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLPELAESSLPAGPAPEEGEGGPEPQPSA
DQGSAELCGSQEVDQPTSGADTGTSDASGGSRRAVSETESLDQGSEPSQVSSETEPSDPARTESVSEAST
RPEGESDLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQES
VCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEGAAAAAESPPQEEGSAGEAQGTCEGA
TAQEEGATGGSQANGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTTWQRPTA
PPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTNAIDGAGEEADFHQASADFRRENILPHSTSR
SRITLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMITKVRRDTHHFERYQHNRDLVGFLNMF
ANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLPLQSSRPTSALVHRQHLTRQRSHSAGEVGEDS
RHAGPPVLPRPSSTFNTVSRPQYQDMVPVAYNDKIVAFLRQPNIFEILQERQPDLTRNHSLREKIQFIRT
EGTPGLVRLSSDADLVMLLSLFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYK
RDFEAKLRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSG
PSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLALIHQYLLDAFFTR
PFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEVFGQITERELKPGGANIPVTEK
NKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIAGTAEIDLSDWRNNTEYRGG
YHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTC
FNRLDLPPYPSFSMLYEKLLTAVEETSTFGLE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020760
ORF Size 4716 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020760.4
RefSeq Size 6926 bp
RefSeq ORF 4719 bp
Locus ID 57520
UniProt ID Q9P2P5
Cytogenetics 2q32.3
Protein Families Druggable Genome
MW 175.6 kDa
Gene Summary This gene encodes a member of a family of E3 ubiquitin ligases which plays an important role in the proliferation, migration and differentiation of neural crest cells as a regulator of glial cell line-derived neurotrophic factor (GDNF)/Ret signaling. This gene also plays an important role in angiogenesis through stabilization of endothelial cell-to-cell junctions as a regulator of angiomotin-like 1 stability. The encoded protein contains an N-terminal calcium/lipid-binding (C2) domain involved in membrane targeting, two-four WW domains responsible for cellular localization and substrate recognition, and a C-terminal homologous with E6-associated protein C-terminus (HECT) catalytic domain. Naturally occurring mutations in this gene are associated with neurodevelopmental delay, hypotonia, and epilepsy. The decreased expression of this gene in the aganglionic colon is associated with Hirschsprung's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.