AKAP6 (NM_004274) Human Tagged ORF Clone

CAT#: RC215986

AKAP6 (Myc-DDK-tagged)-Human A kinase (PRKA) anchor protein 6 (AKAP6)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name AKAP6 (NM_004274) Human Tagged ORF Clone
Symbol AKAP6
Synonyms ADAP100; ADAP6; AKAP100; mAKAP; PRKA6
Vector pCMV6-Entry
Sequence Data
>RC215986 representing NM_004274
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTAACCATGAGCGTGACACTTTCCCCCCTGAGGTCACAGGACCTGGATCCCATGGCTACTGATGCTT
CACCCATGGCCATCAACATGACACCCACTGTGGAGCAGGGTGAGGGAGAAGAGGCAATGAAGGACATGGA
CTCTGACCAGCAGTATGAAAAGCCACCCCCACTACACACAGGGGCTGACTGGAAGATTGTCCTCCACTTA
CCTGAAATTGAGACCTGGCTCCGGATGACCTCAGAGAGGGTCCGAGACCTAACCTATTCAGTCCAGCAGG
ATTCGGACAGCAAGCATGTGGATGTACATCTAGTTCAACTAAAGGACATTTGTGAAGATATTTCTGATCA
TGTTGAGCAAATCCATGCCCTCCTTGAAACAGAGTTCTCCCTAAAGCTGCTGTCTTACTCTGTCAACGTG
ATAGTGGACATCCACGCAGTGCAGCTCCTCTGGCACCAGCTTCGAGTCTCAGTGCTGGTTCTGCGGGAGC
GCATTCTGCAAGGTCTGCAGGACGCCAATGGCAACTACACTAGGCAGACGGACATTCTGCAAGCTTTCTC
TGAAGAGACAAAAGAGGGCCGGCTTGATTCTCTAACAGAAGTGGATGACTCAGGACAATTAACCATCAAA
TGTTCTCAAAATTACTTGTCTCTGGATTGTGGCATTACTGCATTCGAACTGTCTGACTACAGTCCAAGTG
AGGATTTGCTCAGTGGGCTAGGTGACATGACCTCTAGCCAAGTCAAAACCAAACCCTTTGACTCTTGGAG
CTACAGTGAGATGGAAAAGGAGTTTCCTGAGCTTATCCGAAGTGTTGGTTTACTTACGGTAGCTGCTGAC
TCTATCTCTACCAATGGCAGTGAAGCAGTTACTGAGGAGGTATCTCAAGTATCTCTCTCAGTAGACGACA
AAGGTGGATGTGAGGAAGACAATGCTTCTGCAGTCGAAGAGCAACCAGGCTTAACACTGGGGGTGTCATC
ATCTTCAGGAGAAGCTCTGACAAATGCTGCTCAACCCTCCTCTGAGACTGTGCAGCAAGAATCCAGTTCC
TCCTCCCATCATGATGCAAAGAATCAGCAGCCTGTTCCTTGTGAAAATGCAACCCCCAAACGAACCATCA
GAGATTGCTTTAATTATAACGAGGACTCTCCCACACAGCCTACATTGCCAAAAAGAGGACTTTTTCTTAA
AGAGGAAACTTTTAAGAATGATCTGAAAGGCAATGGTGGAAAGAGGCAAATGGTTGATCTAAAGCCTGAG
ATGAGCAGAAGCACCCCTTCGCTAGTAGATCCTCCTGACAGATCCAAACTTTGCCTGGTATTGCAGTCTT
CTTACCCCAACAGCCCTTCTGCTGCCAGCCAGTCTTATGAGTGTTTACACAAGGTGGGGAATGGGAACCT
TGAAAACACAGTCAAATTTCACATTAAAGAAATTTCTTCCAGCCTGGGAAGGCTTAACGACTGCTATAAA
GAGAAATCTCGACTTAAAAAGCCACACAAGACCTCAGAAGAGGTGCCTCCATGCCGAACACCTAAACGGG
GGACTGGTTCAGGCAAACAAGCTAAAAATACAAAGAGCTCAGCAGTGCCAAATGGAGAGCTTTCTTATAC
TTCCAAGGCCATAGAGGGGCCACAAACAAATTCTGCTTCCACATCCTCACTTGAGCCTTGTAATCAGAGA
AGTTGGAATGCCAAATTGCAATTGCAGTCAGAAACATCCAGTTCACCAGCTTTTACTCAGAGCAGTGAAT
CCTCTGTTGGCTCAGACAACATCATGTCTCCGGTGCCACTTCTTTCAAAACACAAAAGCAAAAAAGGTCA
AGCCTCCTCTCCAAGTCACGTCACTAGGAATGGTGAGGTTGTGGAGGCCTGGTATGGCTCTGATGAATAC
CTAGCACTGCCCTCTCACCTTAAGCAGACAGAAGTATTGGCTTTGAAGTTGGAAAACCTAACAAAGCTTC
TGCCTCAGAAACCCAGAGGAGAAACCATCCAGAATATTGATGACTGGGAACTGTCTGAAATGAATTCAGA
TTCTGAAATCTATCCAACCTATCATGTCAAAAAGAAGCATACAAGGCTAGGCAGGGTGTCTCCAAGCTCA
TCTAGTGACATAGCCTCTTCACTAGGGGAGAGCATTGAATCTGGGCCCCTGAGTGACATTCTTTCTGATG
AGGAGTCCAGTATGCCTCTCGCTGGCATGAAAAAGTATGCTGATGAGAAGTCAGAAAGAGCTTCATCCTC
TGAGAAAAATGAGAGCCATTCTGCCACTAAATCAGCTTTAATTCAGAAACTGATGCAAGATATTCAGCAC
CAAGACAACTATGAAGCCATATGGGAAAAAATAGAGGGGTTTGTAAACAAACTGGATGAATTCATTCAAT
GGTTAAATGAAGCCATGGAAACTACAGAGAATTGGACTCCCCCTAAAGCAGAGATGGATGACCTTAAACT
GTATCTGGAGACACACTTGAGTTTTAAGTTGAATGTAGACAGTCATTGTGCTCTCAAGGAAGCTGTGGAG
GAGGAAGGACACCAACTTCTTGAGCTTATTGCATCTCACAAAGCAGGACTGAAGGACATGCTGCGGATGA
TTGCAAGTCAATGGAAGGAGCTGCAGAGGCAAATCAAACGGCAGCACAGCTGGATTCTCAGGGCTCTGGA
TACCATCAAAGCCGAGATACTGGCTACTGATGTGTCTGTGGAGGATGAGGAAGGGACTGGAAGCCCCAAG
GCTGAGGTTCAACTATGCTACCTGGAAGCACAAAGAGATGCTGTTGAGCAGATGTCCCTCAAGCTGTACA
GCGAGCAGTATACCAGCAGCAGCAAGCGAAAGGAAGAGTTTGCTGATATGTCAAAAGTTCATTCAGTGGG
AAGCAATGGGCTTCTGGACTTTGATTCAGAATATCAGGAGCTCTGGGATTGGCTGATTGACATGGAGTCC
CTTGTGATGGACAGCCACGACCTGATGATGTCAGAGGAGCAGCAGCAGCATCTTTACAAGCGATACAGTG
TGGAAATGTCCATCAGACACCTGAAAAAGACGGAGCTGCTTAGTAAGGTTGAAGCTTTGAAGAAAGGTGG
CGTTTTACTACCAAATGATCTCCTTGAAAAAGTGGATTCAATTAATGAAAAATGGGAACTGCTTGGGAAA
ACCCTAGGAGAGAAGATCCAGGACACAATGGCAGGGCACAGTGGGTCGAGTCCACGTGACCTGCTCTCTC
CTGAAAGTGGAAGCCTGGTAAGGCAGCTGGAGGTCAGGATCAAAGAACTGAAAGGATGGCTAAGAGATAC
AGAGCTTTTCATCTTCAATTCCTGTCTGAGACAAGAAAAGGAAGGAACAATGAATACTGAGAAACAACTG
CAATACTTTAAGTCCCTCTGTCGTGAAATCAAGCAACGACGTCGAGGAGTTGCCTCCATTCTGCGACTAT
GCCAGCATCTTTTGGATGACCGGGAGACTTGCAATCTGAATGCAGATCACCAGCCCATGCAGCTGATCAT
TGTAAATCTTGAAAGAAGGTGGGAAGCCATTGTCATGCAAGCCGTCCAGTGGCAAACACGTCTACAAAAG
AAGATGGGAAAGGAATCTGAGACTTTGAATGTGATTGATCCTGGCTTGATGGACCTAAATGGGATGAGTG
AGGATGCCCTGGAATGGGATGAAATGGACATAAGTAACAAGTTAATTAGTTTGAATGAGGAATCAAATGA
CCTTGATCAAGAACTCCAACCTGTTATCCCTTCCTTGAAGCTTGGAGAGACAAGTAATGAGGACCCTGGT
TATGACGAGGAGGCTGATAACCATGGGGGATCTCAGTATGCCTCAAATATTACTGCCCCCTCTAGTCCAC
ACATTTACCAGGTGTACAGCCTCCACAATGTTGAACTCTATGAGGACAACCACATGCCATTTCTGAAAAA
CAATCCAAAGGTCACTGGCATGACACAGCCTAATGTTTTAACTAAGAGTCTCAGTAAAGACTCTTCATTT
TCATCTACCAAATCTTTGCCAGATCTTCTAGGTGGTTCCAATTTGGTAAAGCCCTGCGCATGTCATGGAG
GAGACATGAGCCAGAATTCAGGCAGTGAGAGTGGAATTGTCAGTGAAGGAGACACAGAAACCACTACCAA
CTCTGAAATGTGCTTGCTCAATGCAGTGGATGGGTCCCCAAGTAACCTTGAAACTGAACATCTGGACCCA
CAAATGGGAGATGCAGTTAACGTGTTAAAGCAAAAATTTACAGATGAGGGGGAAAGCATTAAGCTTCCAA
ATAGCTCTCAGTCGTCCATTTCACCAGTGGGTTGTGTAAATGGAAAAGTTGGAGATTTAAACAGTATTAC
CAAACATACCCCTGACTGTTTGGGAGAAGAATTACAAGGAAAACATGATGTGTTTACATTTTATGATTAC
TCATACCTCCAAGGCTCAAAACTCAAATTACCAATGATAATGAAACAGTCACAAAGCGAAAAAGCGCATG
TGGAGGATCCCCTGCTTCGTGGTTTTTATTTTGATAAAAAATCATGCAAATCTAAACATCAGACTACAGA
GTTACAACCAGATGTACCTCCCCATGAAAGGATTTTGGCAAGTGCATCTCATGAAATGGATCGCATTTCA
TATAAAAGTGGCAATATAGAAAAGACATTCACTGGCATGCAGAATGCCAAACAGCTCTCCCTTTTATCTC
ATAGTTCATCTATTGAGTCCCTTTCTCCAGGGGGTGATTTATTTGGATTGGGCATCTTTAAAAATGGCAG
TGACAGCCTCCAGCGAAGCACTTCTTTAGAAAGTTGGTTGACTTCCTATAAAAGCAATGAAGATCTCTTT
AGCTGTCACAGCTCTGGGGATATAAGCGTGAGCAGTGGCTCAGTTGGTGAACTAAGTAAAAGAACATTAG
ATCTCCTGAATCGTTTGGAGAATATCCAGAGCCCCTCAGAGCAAAAGATAAAACGAAGTGTTTCTGATAT
CACTCTTCAAAGCAGTTCCCAAAAGATGTCCTTTACTGGCCAGATGTCATTGGACATAGCATCTTCTATC
AATGAAGACTCAGCGGCATCTCTAACAGAACTTAGCAGCAGTGACGAGCTCTCTCTTTGCTCAGAGGATA
TTGTGTTACACAAGAACAAGATCCCGGAATCGAATGCATCGTTCAGGAAGCGTCTGACTCGTTCAGTGGC
TGATGAAAGCGATGTCAATGTCAGCATGATTGTTAATGTCTCTTGCACCTCTGCTTGCACTGATGATGAA
GATGACAGCGACCTGCTCTCCAGCTCTACCCTTACCTTGACTGAAGAAGAGCTGTGCATCAAAGATGAGG
ATGACGACTCCAGTATTGCAACAGATGATGAAATTTATGAAGACTGCACCTTGATGTCAGGGCTAGACTA
CATAAAGAATGAATTACAGACCTGGATTAGGCCAAAATTGTCTTTGACAAGAGATAAGAAAAGGTGCAAT
GTCAGTGATGAGATGAAGGGCAGTAAAGATATAAGTAGCAGTGAGATGACCAATCCCTCTGATACTCTGA
ATATTGAGACCCTTCTAAATGGCTCTGTAAAACGTGTCTCTGAAAATAATGGAAATGGTAAGAATTCATC
TCATACCCATGAGTTAGGGACAAAGCGTGAAAATAAGAAAACTATTTTCAAAGTTAATAAAGATCCATAT
GTGGCTGACATGGAAAATGGCAATATTGAAGGTATTCCAGAAAGGCAAAAGGGAAAACCGAATGTGACTT
CAAAGGTATCAGAAAATCTTGGTTCACATGGGAAAGAGATTTCAGAGAGTGAGCATTGTAAGTGTAAAGC
ACTTATGGATAGTTTAGATGATTCAAATACTGCTGGCAAGGAATTTGTTTCCCAAGATGTTAGACATCTT
CCAAAGAAATGTCCAAATCACCACCATTTTGAAAATCAAAGCACTGCCTCTACTCCCACTGAGAAGTCTT
TCTCAGAACTGGCTTTAGAAACCAGGTTTAACAACAGACAAGACTCTGATGCACTGAAATCATCTGATGA
TGCACCGAGTATGGCTGGAAAATCTGCTGGTTGTTGCCTAGCACTTGAACAAAACGGAACAGAGGAAAAT
GCTTCTATCAGCGACATTTCCTGTTGCAACTGTGAGCCAGATGTTTTCCATCAAAAAGATGCCGAAGATT
GTTCAGTACACAACTTTGTTAAGGAAATCATTGACATGGCTTCGACAGCCCTAAAAAGTAAATCTCAACC
TGAAAACGAGGTGGCTGCTCCTACTTCATTAACTCAAATCAAGGAGAAAGTGTTGGAGCATTCTCACCGG
CCCATCCAGCTGAGAAAAGGGGACTTTTATTCGTACTTATCTCTCTCATCTCATGACAGTGATTGTGGGG
AGGTCACCAATTACATAGAAGAGAAAAGCAGCACTCCATTGCCACTAGACACCACTGACTCGGGCTTAGA
TGACAAGGAAGATATTGAATGCTTTTTTGAGGCCTGTGTTGAGGGTGACTCTGATGGAGAGGAGCCTTGT
TACTCTAGTGCTCCTCCAAATGAATCTGCAGTTCCCAGCGAAGCTGCAATGCCACTACAAGCAACAGCAT
GTTCTTCTGAGTTCAGTGATAGTTCTCTTTCAGCTGATGATGCAGATACAGTGGCTCTTTCAAGTCCTTC
CTCTCAGGAAAGAGCTGAGGTTGGAAAGGAAGTGAATGGTTTGCCCCAAACTTCCAGTGGCTGTGCAGAA
AACTTAGAGTTTACTCCTTCAAAGCTTGACAGTGAAAAGGAAAGTTCCGGAAAACCAGGTGAATCTGGAA
TGCCAGAAGAACATAATGCTGCTTCAGCCAAATCTAAAGTTCAAGACCTCTCCTTGAAGGCAAATCAGCC
AACAGACAAGGCCGCATTGCATCCCAGCCCCAAAACTTTAACCTGTGAAGAAAATCTTCTAAACCTTCAT
GAAAAACGACATAGAAATATGCATAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215986 representing NM_004274
Red=Cloning site Green=Tags(s)

MLTMSVTLSPLRSQDLDPMATDASPMAINMTPTVEQGEGEEAMKDMDSDQQYEKPPPLHTGADWKIVLHL
PEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQIHALLETEFSLKLLSYSVNV
IVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQTDILQAFSEETKEGRLDSLTEVDDSGQLTIK
CSQNYLSLDCGITAFELSDYSPSEDLLSGLGDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLTVAAD
SISTNGSEAVTEEVSQVSLSVDDKGGCEEDNASAVEEQPGLTLGVSSSSGEALTNAAQPSSETVQQESSS
SSHHDAKNQQPVPCENATPKRTIRDCFNYNEDSPTQPTLPKRGLFLKEETFKNDLKGNGGKRQMVDLKPE
MSRSTPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKVGNGNLENTVKFHIKEISSSLGRLNDCYK
EKSRLKKPHKTSEEVPPCRTPKRGTGSGKQAKNTKSSAVPNGELSYTSKAIEGPQTNSASTSSLEPCNQR
SWNAKLQLQSETSSSPAFTQSSESSVGSDNIMSPVPLLSKHKSKKGQASSPSHVTRNGEVVEAWYGSDEY
LALPSHLKQTEVLALKLENLTKLLPQKPRGETIQNIDDWELSEMNSDSEIYPTYHVKKKHTRLGRVSPSS
SSDIASSLGESIESGPLSDILSDEESSMPLAGMKKYADEKSERASSSEKNESHSATKSALIQKLMQDIQH
QDNYEAIWEKIEGFVNKLDEFIQWLNEAMETTENWTPPKAEMDDLKLYLETHLSFKLNVDSHCALKEAVE
EEGHQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVEDEEGTGSPK
AEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSVGSNGLLDFDSEYQELWDWLIDMES
LVMDSHDLMMSEEQQQHLYKRYSVEMSIRHLKKTELLSKVEALKKGGVLLPNDLLEKVDSINEKWELLGK
TLGEKIQDTMAGHSGSSPRDLLSPESGSLVRQLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNTEKQL
QYFKSLCREIKQRRRGVASILRLCQHLLDDRETCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQK
KMGKESETLNVIDPGLMDLNGMSEDALEWDEMDISNKLISLNEESNDLDQELQPVIPSLKLGETSNEDPG
YDEEADNHGGSQYASNITAPSSPHIYQVYSLHNVELYEDNHMPFLKNNPKVTGMTQPNVLTKSLSKDSSF
SSTKSLPDLLGGSNLVKPCACHGGDMSQNSGSESGIVSEGDTETTTNSEMCLLNAVDGSPSNLETEHLDP
QMGDAVNVLKQKFTDEGESIKLPNSSQSSISPVGCVNGKVGDLNSITKHTPDCLGEELQGKHDVFTFYDY
SYLQGSKLKLPMIMKQSQSEKAHVEDPLLRGFYFDKKSCKSKHQTTELQPDVPPHERILASASHEMDRIS
YKSGNIEKTFTGMQNAKQLSLLSHSSSIESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLF
SCHSSGDISVSSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQKMSFTGQMSLDIASSI
NEDSAASLTELSSSDELSLCSEDIVLHKNKIPESNASFRKRLTRSVADESDVNVSMIVNVSCTSACTDDE
DDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDEIYEDCTLMSGLDYIKNELQTWIRPKLSLTRDKKRCN
VSDEMKGSKDISSSEMTNPSDTLNIETLLNGSVKRVSENNGNGKNSSHTHELGTKRENKKTIFKVNKDPY
VADMENGNIEGIPERQKGKPNVTSKVSENLGSHGKEISESEHCKCKALMDSLDDSNTAGKEFVSQDVRHL
PKKCPNHHHFENQSTASTPTEKSFSELALETRFNNRQDSDALKSSDDAPSMAGKSAGCCLALEQNGTEEN
ASISDISCCNCEPDVFHQKDAEDCSVHNFVKEIIDMASTALKSKSQPENEVAAPTSLTQIKEKVLEHSHR
PIQLRKGDFYSYLSLSSHDSDCGEVTNYIEEKSSTPLPLDTTDSGLDDKEDIECFFEACVEGDSDGEEPC
YSSAPPNESAVPSEAAMPLQATACSSEFSDSSLSADDADTVALSSPSSQERAEVGKEVNGLPQTSSGCAE
NLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLH
EKRHRNMHR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004274
ORF Size 6957 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004274.2, NM_004274.3, NM_004274.4, NP_004265
RefSeq Size 10342
RefSeq ORF 6960
Locus ID 9472
Cytogenetics 14q12
Domains spectrin
Protein Families Druggable Genome
MW 256.5 kDa
Gene Summary The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)