FTO (NM_001080432) Human Tagged ORF Clone

CAT#: RC215889

FTO (Myc-DDK-tagged)-Human fat mass and obesity associated (FTO)

Need custom modification / cloning service?
Get a free quote

USD 649.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name FTO (NM_001080432) Human Tagged ORF Clone
Symbol FTO
Synonyms ALKBH9; BMIQ14; GDFD
Vector pCMV6-Entry
Sequence Data
>RC215889 representing NM_001080432
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCGCACCCCGACTGCCGAGGAACGAGAGCGCGAAGCTAAGAAACTGAGGCTTCTTGAAGAGCTTG
AAGACACTTGGCTCCCTTATCTGACCCCCAAAGATGATGAATTCTATCAGCAGTGGCAGCTGAAATATCC
TAAACTAATTCTCCGAGAAGCCAGCAGTGTATCTGAGGAGCTCCATAAAGAGGTTCAAGAAGCCTTTCTC
ACACTGCACAAGCATGGCTGCTTATTTCGGGACCTGGTTAGGATCCAAGGCAAAGATCTGCTCACTCCGG
TATCTCGCATCCTCATTGGTAATCCAGGCTGCACCTACAAGTACCTGAACACCAGGCTCTTTACGGTCCC
CTGGCCAGTGAAAGGGTCTAATATAAAACACACCGAGGCTGAAATAGCCGCTGCTTGTGAGACCTTCCTC
AAGCTCAATGACTACCTGCAGATAGAAACCATCCAGGCTTTGGAAGAACTTGCTGCCAAAGAGAAGGCTA
ATGAGGATGCTGTGCCATTGTGTATGTCTGCAGATTTCCCCAGGGTTGGGATGGGTTCATCCTACAACGG
ACAAGATGAAGTGGACATTAAGAGCAGAGCAGCATACAACGTAACTTTGCTGAATTTCATGGATCCTCAG
AAAATGCCATACCTGAAAGAGGAACCTTATTTTGGCATGGGGAAAATGGCAGTGAGCTGGCATCATGATG
AAAATCTGGTGGACAGGTCAGCGGTGGCAGTGTACAGTTATAGCTGTGAAGGCCCTGAAGAGGAAAGTGA
GGATGACTCTCATCTCGAAGGCAGGGATCCTGATATTTGGCATGTTGGTTTTAAGATCTCATGGGACATA
GAGACACCTGGTTTGGCGATACCCCTTCACCAAGGAGACTGCTATTTCATGCTTGATGATCTCAATGCCA
CCCACCAACACTGTGTTTTGGCCGGTTCACAACCTCGGTTTAGTTCCACCCACCGAGTGGCAGAGTGCTC
AACAGGAACCTTGGATTATATTTTACAACGCTGTCAGTTGGCTCTGCAGAATGTCTGTGACGATGTGGAC
AATGATGATGTCTCTTTGAAATCCTTTGAGCCTGCAGTTTTGAAACAAGGAGAAGAAATTCATAATGAGG
TCGAGTTTGAGTGGCTGAGGCAGTTTTGGTTTCAAGGCAATCGATACAGAAAGTGCACTGACTGGTGGTG
TCAACCCATGGCTCAACTGGAAGCACTGTGGAAGAAGATGGAGGGTGTGACAAATGCTGTGCTTCATGAA
GTTAAAAGAGAGGGGCTCCCCGTGGAACAAAGGAATGAAATCTTGACTGCCATCCTTGCCTCGCTCACTG
CACGCCAGAACCTGAGGAGAGAATGGCATGCCAGGTGCCAGTCACGAATTGCCCGAACATTACCTGCTGA
TCAGAAGCCAGAATGTCGGCCATACTGGGAAAAGGATGATGCTTCGATGCCTCTGCCGTTTGACCTCACA
GACATCGTTTCAGAACTCAGAGGTCAGCTTCTGGAAGCAAAACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215889 representing NM_001080432
Red=Cloning site Green=Tags(s)

MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFL
TLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFL
KLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVGMGSSYNGQDEVDIKSRAAYNVTLLNFMDPQ
KMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDI
ETPGLAIPLHQGDCYFMLDDLNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVD
NDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLT
DIVSELRGQLLEAKP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001080432
ORF Size 1515 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001080432.1, NM_001080432.2, NP_001073901
RefSeq Size 4294
RefSeq ORF 1518
Locus ID 79068
Cytogenetics 16q12.2
MW 58.1 kDa
Gene Summary This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes. [provided by RefSeq, Jul 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)