ZDHHC20 (NM_153251) Human Tagged ORF Clone

CAT#: RC215317

Reviews ()
Write a review

ZDHHC20 (Myc-DDK-tagged)-Human zinc finger, DHHC-type containing 20 (ZDHHC20)



  "NM_153251" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZDHHC20
Synonyms 4933421L13Rik; DHHC-20; DHHC20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215317 representing NM_153251
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCTGGACGCTGTGGCGCTGCTGCCAGCGCGTCGTGGGCTGGGTGCCGGTGCTCTTCATCACCT
TCGTGGTCGTCTGGTCCTACTACGCGTACGTGGTGGAGCTCTGCGTGTTTACTATTTTTGGAAATGAAGA
AAATGGAAAGACCGTTGTTTACCTTGTGGCTTTCCATCTGTTCTTTGTTATGTTTGTATGGTCCTATTGG
ATGACAATTTTCACATCTCCCGCTTCCCCCTCCAAAGAGTTCTACTTGTCCAATTCTGAAAAGGAACGTT
ATGAAAAAGAATTCAGCCAAGAAAGACAACAAGAAATTTTGAGAAGAGCAGCAAGAGCTTTACCTATCTA
TACCACATCAGCTTCAAAAACTATCAGATATTGTGAAAAATGTCAGCTGATTAAACCTGATCGGGCGCAT
CACTGCTCAGCCTGTGACTCATGTATTCTTAAGATGGATCATCACTGTCCTTGGGTGAATAACTGTGTGG
GATTTTCTAATTACAAATTCTTCCTGCTGTTTTTATTGTATTCCCTATTATATTGCCTTTTCGTGGCTGC
AACAGTTTTAGAGTACTTTATAAAATTTTGGACGAATGAACTGACAGATACACGTGCAAAATTCCACGTA
CTTTTTCTTTTCTTTGTGTCTGCAATGTTCTTCATCAGCGTCCTCTCACTTTTCAGCTACCACTGCTGGC
TAGTTGGAAAAAATAGAACAACAATAGAATCATTCCGCGCACCCACGTTTTCATACGGACCTGATGGAAA
TGGTTTCTCTCTTGGATGCAGTAAAAATTGGAGACAAGTCTTTGGTGATGAAAAGAAATATTGGCTACTT
CCAATATTTTCAAGCTTGGGTGATGGTTGCAGTTTTCCAACTCGCCTTGTGGGGATGGATCCAGAACAAG
CTTCTGTTACAAACCAGAATGAGTATGCCAGAAGTGGCTCAAATCAACCTTTTCCTATCAAACCACTTAG
TGAATCAAAAAACCGCTTGTTGGACAGTGAATCTCAGTGGCTGGAGAATGGAGCTGAAGAAGGCATCGTC
AAATCAGGTGTA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC215317 representing NM_153251
Red=Cloning site Green=Tags(s)

MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYW
MTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAH
HCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHV
LFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLL
PIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIV
KSGV

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_153251
ORF Size 1062 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_153251.3, NP_694983.2
RefSeq Size 1514 bp
RefSeq ORF 1065 bp
Locus ID 253832
UniProt ID Q5W0Z9
Cytogenetics 13q12.11
Protein Families Transmembrane
MW 40.9 kDa
Gene Summary Catalyzes palmitoylation of Cys residues on target proteins (PubMed:27153536, PubMed:29326245). Catalyzes palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, and modulates the duration of EGFR signaling by modulating palmitoylation-dependent EGFR internalization and degradation (PubMed:27153536). Has a preference for acyl-CoA with C16 fatty acid chains (PubMed:29326245). Can also utilize acyl-CoA with C14 and C18 fatty acid chains (PubMed:29326245).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "ZDHHC20"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


ZDHHC20 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.