H3FA(HIST1H3A) (NM_003529) Human Tagged ORF Clone

CAT#: RC214879

HIST1H3A (Myc-DDK-tagged)-Human histone cluster 1, H3a (HIST1H3A)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name H3FA(HIST1H3A) (NM_003529) Human Tagged ORF Clone
Symbol HIST1H3A
Synonyms H3/A; H3FA
Vector pCMV6-Entry
Sequence Data
>RC214879 representing NM_003529
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGCACTAAGCAAACTGCTCGGAAGTCTACTGGTGGCAAGGCGCCACGCAAACAGTTGGCCACTA
AGGCAGCCCGCAAAAGCGCTCCGGCCACCGGCGGCGTGAAAAAGCCCCACCGCTACCGGCCGGGCACCGT
GGCTCTGCGCGAGATCCGCCGTTATCAGAAGTCCACTGAACTGCTTATTCGTAAACTACCTTTCCAGCGC
CTGGTGCGCGAGATTGCGCAGGACTTTAAAACAGACCTGCGTTTCCAGAGCTCCGCTGTGATGGCTCTGC
AGGAGGCGTGCGAGGCCTACTTGGTAGGGCTATTTGAGGACACTAACCTGTGCGCCATCCACGCCAAGCG
CGTCACTATCATGCCCAAGGACATCCAGCTCGCCCGCCGCATCCGCGGAGAGAGGGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214879 representing NM_003529
Red=Cloning site Green=Tags(s)

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
LVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003529
ORF Size 408 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003529.1, NM_003529.2, NP_003520
RefSeq Size 469
RefSeq ORF 411
Locus ID 8350
Cytogenetics 6p22.2
Protein Pathways Systemic lupus erythematosus
MW 15.2 kDa
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)