p95 NBS1 (NBN) (NM_002485) Human Tagged ORF Clone

CAT#: RC214682

Reviews ()
Write a review

NBN (Myc-DDK-tagged)-Human nibrin (NBN)



Reconstitution Protocol

USD 690.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NBN
Synonyms AT-V1; AT-V2; ATV; NBS; NBS1; P95
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214682 representing NM_002485
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAAACTGCTGCCCGCCGCGGGCCCGGCAGGAGGAGAACCATACAGACTTTTGACTGGCGTTGAGT
ACGTTGTTGGAAGGAAAAACTGTGCCATTCTGATTGAAAATGATCAGTCGATCAGCCGAAATCATGCTGT
GTTAACTGCTAACTTTTCTGTAACCAACCTGAGTCAAACAGATGAAATCCCTGTATTGACATTAAAAGAT
AATTCTAAGTATGGTACCTTTGTTAATGAGGAAAAAATGCAGAATGGCTTTTCCCGAACTTTGAAGTCGG
GGGATGGTATTACTTTTGGAGTGTTTGGAAGTAAATTCAGAATAGAGTATGAGCCTTTGGTTGCATGCTC
TTCTTGTTTAGATGTCTCTGGGAAAACTGCTTTAAATCAAGCTATATTGCAACTTGGAGGATTTACTGTA
AACAATTGGACAGAAGAATGCACTCACCTTGTCATGGTATCAGTGAAAGTTACCATTAAAACAATATGTG
CACTCATTTGTGGACGTCCAATTGTAAAGCCAGAATATTTTACTGAATTCCTGAAAGCAGTTGAGTCCAA
GAAGCAGCCTCCACAAATTGAAAGTTTTTACCCACCTCTTGATGAACCATCTATTGGAAGTAAAAATGTT
GATCTGTCAGGACGGCAGGAAAGAAAACAAATCTTCAAAGGGAAAACATTTATATTTTTGAATGCCAAAC
AGCATAAGAAATTGAGTTCCGCAGTTGTCTTTGGAGGTGGGGAAGCTAGGTTGATAACAGAAGAGAATGA
AGAAGAACATAATTTCTTTTTGGCTCCGGGAACGTGTGTTGTTGATACAGGAATAACAAACTCACAGACC
TTAATTCCTGACTGTCAGAAGAAATGGATTCAGTCAATAATGGATATGCTCCAAAGGCAAGGTCTTAGAC
CTATTCCTGAAGCAGAAATTGGATTGGCGGTGATTTTCATGACTACAAAGAATTACTGTGATCCTCAGGG
CCATCCCAGTACAGGATTAAAGACAACAACTCCAGGACCAAGCCTTTCACAAGGCGTGTCAGTTGATGAA
AAACTAATGCCAAGCGCCCCAGTGAACACTACAACATACGTAGCTGACACAGAATCAGAGCAAGCAGATA
CATGGGATTTGAGTGAAAGGCCAAAAGAAATCAAAGTCTCCAAAATGGAACAAAAATTCAGAATGCTTTC
ACAAGACGCACCCACTGTAAAGGAGTCCTGCAAAACAAGCTCTAATAATAATAGTATGGTATCAAATACT
TTGGCTAAGATGAGAATCCCAAACTATCAGCTTTCACCAACTAAATTGCCAAGTATAAATAAAAGTAAAG
ATAGGGCTTCTCAGCAGCAGCAGACCAACTCCATCAGAAACTACTTTCAGCCGTCTACCAAAAAAAGGGA
AAGGGATGAAGAAAATCAAGAAATGTCTTCATGCAAATCAGCAAGAATAGAAACGTCTTGTTCTCTTTTA
GAACAAACACAACCTGCTACACCCTCATTGTGGAAAAATAAGGAGCAGCATCTATCTGAGAATGAGCCTG
TGGACACAAACTCAGACAATAACTTATTTACAGATACAGATTTAAAATCTATTGTGAAAAATTCTGCCAG
TAAATCTCATGCTGCAGAAAAGCTAAGATCAAATAAAAAAAGGGAAATGGATGATGTGGCCATAGAAGAT
GAAGTATTGGAACAGTTATTCAAGGACACAAAACCAGAGTTAGAAATTGATGTGAAAGTTCAAAAACAGG
AGGAAGATGTCAATGTTAGAAAAAGGCCAAGGATGGATATAGAAACAAATGACACTTTCAGTGATGAAGC
AGTACCAGAAAGTAGCAAAATATCTCAAGAAAATGAAATTGGGAAGAAACGTGAACTCAAGGAAGACTCA
CTATGGTCAGCTAAAGAAATATCTAACAATGACAAACTTCAGGATGATAGTGAGATGCTTCCAAAAAAGC
TGTTATTGACTGAATTTAGATCACTGGTGATTAAAAACTCTACTTCCAGAAATCCATCTGGCATAAATGA
TGATTATGGTCAACTAAAAAATTTCAAGAAATTCAAAAAGGTCACATATCCTGGAGCAGGAAAACTTCCA
CACATCATTGGAGGATCAGATCTAATAGCTCATCATGCTCGAAAGAATACAGAACTAGAAGAGTGGCTAA
GGCAGGAAATGGAGGTACAAAATCAACATGCAAAAGAAGAGTCTCTTGCTGATGATCTTTTTAGATACAA
TCCTTATTTAAAAAGGAGAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214682 representing NM_002485
Red=Cloning site Green=Tags(s)

MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKD
NSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTV
NNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNV
DLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQT
LIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDE
KLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDAPTVKESCKTSSNNNSMVSNT
LAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLL
EQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIED
EVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDS
LWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLP
HIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002485
ORF Size 2262 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002485.5
RefSeq Size 4639 bp
RefSeq ORF 2265 bp
Locus ID 4683
UniProt ID O60934
Cytogenetics 8q21.3
Domains FHA
Protein Families Druggable Genome
Protein Pathways Homologous recombination
MW 84.8 kDa
Gene Summary Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.