NFkB p100 / p52 (NFKB2) (NM_002502) Human Tagged ORF Clone

CAT#: RC213313

Reviews ()
Write a review

NFKB2 (Myc-DDK-tagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100) (NFKB2), transcript variant 2



Reconstitution Protocol

USD 823.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NFKB2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NFKB2
Synonyms CVID10; H2TF1; LYT-10; LYT10; NF-kB2; p49/p100; p52; p100
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213313 representing NM_002502.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGAGAGTTGCTACAACCCAGGTCTGGATGGTATTATTGAATATGATGATTTCAAATTGAACTCCTCC
ATTGTGGAACCCAAGGAGCCAGCCCCAGAAACAGCTGATGGCCCCTACCTGGTGATCGTGGAACAGCCT
AAGCAGAGAGGCTTTCGATTTCGATATGGCTGTGAAGGCCCCTCCCATGGAGGACTGCCCGGTGCCTCC
AGTGAGAAGGGCCGAAAGACCTATCCCACTGTCAAGATCTGTAACTACGAGGGACCAGCCAAGATCGAG
GTGGACCTGGTAACACACAGTGACCCACCTCGTGCTCATGCCCACAGTCTGGTGGGCAAGCAATGCTCG
GAGCTGGGGATCTGCGCCGTTTCTGTGGGGCCCAAGGACATGACTGCCCAATTTAACAACCTGGGTGTC
CTGCATGTGACTAAGAAGAACATGATGGGGACTATGATACAAAAACTTCAGAGGCAGCGGCTCCGCTCT
AGGCCCCAGGGCCTTACGGAGGCCGAGCAGCGGGAGCTGGAGCAAGAGGCCAAAGAACTGAAGAAGGTG
ATGGATCTGAGTATAGTGCGGCTGCGCTTCTCTGCCTTCCTTAGAGCCAGTGATGGCTCCTTCTCCCTG
CCCCTGAAGCCAGTCATCTCCCAGCCCATCCATGACAGCAAATCTCCGGGGGCATCAAACCTGAAGATT
TCTCGAATGGACAAGACAGCAGGCTCTGTGCGGGGTGGAGATGAAGTTTATCTGCTTTGTGACAAGGTG
CAGAAAGATGACATTGAGGTTCGGTTCTATGAGGATGATGAGAATGGATGGCAGGCCTTTGGGGACTTC
TCTCCCACAGATGTGCATAAACAGTATGCCATTGTGTTCCGGACACCCCCCTATCACAAGATGAAGATT
GAGCGGCCTGTAACAGTGTTTCTGCAACTGAAACGCAAGCGAGGAGGGGACGTGTCTGATTCCAAACAG
TTCACCTATTACCCTCTGGTGGAAGACAAGGAAGAGGTGCAGCGGAAGCGGAGGAAGGCCTTGCCCACC
TTCTCCCAGCCCTTCGGGGGTGGCTCCCACATGGGTGGAGGCTCTGGGGGTGCAGCCGGGGGCTACGGA
GGAGCTGGAGGAGGTGGCAGCCTCGGTTTCTTCCCCTCCTCCCTGGCCTACAGCCCCTACCAGTCCGGC
GCGGGCCCCATGGGCTGCTACCCGGGAGGCGGGGGCGGGGCGCAGATGGCCGCCACGGTGCCCAGCAGG
GACTCCGGGGAGGAAGCCGCGGAGCCGAGCGCCCCCTCCAGGACCCCCCAGTGCGAGCCGCAGGCCCCG
GAGATGCTGCAGCGAGCTCGAGAGTACAACGCGCGCCTGTTCGGCCTGGCGCAGCGCAGCGCCCGAGCC
CTACTCGACTACGGCGTCACCGCGGACGCGCGCGCGCTGCTGGCGGGACAGCGCCACCTGCTGACGGCG
CAGGACGAGAACGGAGACACACCACTGCACCTAGCCATCATCCACGGGCAGACCAGTGTCATTGAGCAG
ATAGTCTATGTCATCCACCACGCCCAGGACCTCGGCGTTGTCAACCTCACCAACCACCTGCACCAGACG
CCCCTGCACCTGGCGGTGATCACGGGGCAGACGAGTGTGGTGAGCTTTCTGCTGCGGGTAGGTGCAGAC
CCAGCTCTGCTGGATCGGCATGGAGACTCAGCCATGCATCTGGCGCTGCGGGCAGGCGCTGGTGCTCCT
GAGCTGCTGCGTGCACTGCTTCAGAGTGGAGCTCCTGCTGTGCCCCAGCTGTTGCATATGCCTGACTTT
GAGGGACTGTATCCAGTACACCTGGCGGTCCGAGCCCGAAGCCCTGAGTGCCTGGATCTGCTGGTGGAC
AGTGGGGCTGAAGTGGAGGCCACAGAGCGGCAGGGGGGACGAACAGCCTTGCATCTAGCCACAGAGATG
GAGGAGCTGGGGTTGGTCACCCATCTGGTCACCAAGCTCCGGGCCAACGTGAACGCTCGCACCTTTGCG
GGAAACACACCCCTGCACCTGGCAGCTGGACTGGGGTACCCGACCCTCACCCGCCTCCTTCTGAAGGCT
GGTGCTGACATCCATGCTGAAAACGAGGAGCCCCTGTGCCCACTGCCTTCACCCCCTACCTCTGATAGC
GACTCGGACTCTGAAGGGCCTGAGAAGGACACCCGAAGCAGCTTCCGGGGCCACACGCCTCTTGACCTC
ACTTGCAGCACCAAGGTGAAGACCTTGCTGCTAAATGCTGCTCAGAACACCATGGAGCCACCCCTGACC
CCGCCCAGCCCAGCAGGGCCGGGACTGTCACTTGGTGATACAGCTCTGCAGAACCTGGAGCAGCTGCTA
GACGGGCCAGAAGCCCAGGGCAGCTGGGCAGAGCTGGCAGAGCGTCTGGGGCTGCGCAGCCTGGTAGAC
ACGTACCGACAGACAACCTCACCCAGTGGCAGCCTCCTGCGCAGCTACGAGCTGGCTGGCGGGGACCTG
GCAGGTCTACTGGAGGCCCTGTCTGACATGGGCCTAGAGGAGGGAGTGAGGCTGCTGAGGGGTCCAGAA
ACCCGAGACAAGCTGCCCAGCACAGAGGTGAAGGAAGACAGTGCGTACGGGAGCCAGTCAGTGGAGCAG
GAGGCAGAGAAGCTGGGCCCACCCCCTGAGCCACCAGGAGGGCTCTGCCACGGGCACCCCCAGCCTCAG
GTGCAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC213313
Blue=ORF Red=Cloning site Green=Tag(s)

MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGAS
SEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGV
LHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSL
PLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDF
SPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPT
FSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSR
DSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTA
QDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGAD
PALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVD
SGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKA
GADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLT
PPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDL
AGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQ
VH

myc-FLAG tag

Recombinant protein using RC213313 also available, TP313313
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002502
ORF Size 2697 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002502.6
RefSeq Size 3001 bp
RefSeq ORF 2700 bp
Locus ID 4791
UniProt ID Q00653
Cytogenetics 10q24.32
Domains RHD, DEATH, ANK, IPT
Protein Families Transcription Factors
Protein Pathways MAPK signaling pathway, Pathways in cancer
MW 96.7 kDa
Gene Summary This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.