TAF13 (NM_005645) Human Tagged ORF Clone
CAT#: RC212721
TAF13 (Myc-DDK-tagged)-Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_005645" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | TAF13 |
Synonyms | MRT60; TAF(II)18; TAF2K; TAFII-18; TAFII18 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC212721 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGATGAGGAAGAAGACCCCACGTTTGAGGAAGAAAATGAAGAAATTGGAGGAGGTGCAGAAGGTG GACAGGGTAAAAGAAAGAGACTTTTTTCTAAAGAATTGCGATGTATGATGTATGGCTTTGGGGATGACCA GAATCCTTATACTGAGTCAGTGGATATTCTTGAAGATCTTGTCATAGAGTTTATCACTGAAATGACTCAC AAGGCAATGTCAATTGGAAGACAAGGTCGAGTACAAGTTGAAGATATCGTCTTCTTGATTCGAAAGGACC CAAGGAAGTTTGCCAGGGTTAAAGACTTGCTTACTATGAATGAAGAATTGAAACGAGCTAGAAAAGCATT TGATGAAGCAAATTATGGATCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC212721 protein sequence
Red=Cloning site Green=Tags(s) MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTH KAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005645 |
ORF Size | 372 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005645.4 |
RefSeq Size | 577 bp |
RefSeq ORF | 375 bp |
Locus ID | 6884 |
UniProt ID | Q15543 |
Cytogenetics | 1p13.3 |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
MW | 14.3 kDa |
Gene Summary | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC212721L1 | Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), Myc-DDK-tagged |
USD 450.00 |
|
RC212721L2 | Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), mGFP tagged |
USD 450.00 |
|
RC212721L3 | Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), Myc-DDK-tagged |
USD 450.00 |
|
RC212721L4 | Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), mGFP tagged |
USD 450.00 |
|
RG212721 | TAF13 (tGFP-tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13) |
USD 350.00 |
|
SC303676 | TAF13 (untagged)-Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13) |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review