XRCC4 (NM_003401) Human Tagged ORF Clone

CAT#: RC212684

XRCC4 (Myc-DDK-tagged)-Human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name XRCC4 (NM_003401) Human Tagged ORF Clone
Symbol XRCC4
Synonyms SSMED; SSMED
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC212684 representing NM_003401
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGAAAAATAAGCAGAATCCACCTTGTTTCTGAACCCAGTATAACTCATTTTCTACAAGTATCTT
GGGAGAAAACACTGGAATCTGGTTTTGTTATTACACTTACTGATGGTCATTCAGCATGGACTGGGACAGT
TTCTGAATCAGAGATTTCCCAAGAAGCTGATGACATGGCAATGGAAAAAGGGAAATATGTTGGTGAACTG
AGAAAAGCATTGTTGTCAGGAGCAGGACCAGCTGATGTATACACGTTTAATTTTTCTAAAGAGTCTTGTT
ATTTCTTCTTTGAGAAAAACCTGAAAGATGTCTCATTCAGACTTGGTTCCTTCAACCTAGAGAAAGTTGA
AAACCCAGCTGAAGTCATTAGAGAACTTATTTGTTATTGCTTGGACACCATTGCAGAAAATCAAGCCAAA
AATGAGCACCTGCAGAAAGAAAATGAAAGGCTTCTGAGAGATTGGAATGATGTTCAAGGACGATTTGAAA
AATGTGTGAGTGCTAAGGAAGCTTTGGAGACTGATCTTTATAAGCGGTTTATTCTGGTGTTGAATGAGAA
GAAAACAAAAATCAGAAGTTTGCATAATAAATTATTAAATGCAGCTCAAGAACGAGAAAAGGACATCAAA
CAAGAAGGGGAAACTGCAATCTGTTCTGAAATGACTGCTGACCGAGATCCAGTCTATGATGAGAGTACTG
ATGAGGAAAGTGAAAACCAAACTGATCTCTCTGGGTTGGCTTCAGCTGCTGTAAGTAAAGATGATTCCAT
TATTTCAAGTCTTGATGTCACTGATATTGCACCAAGTAGAAAAAGGAGACAGCGAATGCAAAGAAATCTT
GGGACAGAACCTAAAATGGCTCCTCAGGAGAATCAGCTTCAAGAAAAGGAAAATTCTAGGCCTGATTCTT
CACTACCTGAGACGTCTAAAAAGGAGCACATCTCAGCTGAAAACATGTCTTTAGAAACTCTGAGAAACAG
CAGCCCAGAAGACCTCTTTGATGAGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212684 representing NM_003401
Red=Cloning site Green=Tags(s)

MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL
RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK
NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK
QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL
GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003401
ORF Size 1008 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003401.1, NM_003401.2, NM_003401.3, NM_003401.4, NP_003392
RefSeq Size 1660
RefSeq ORF 1005
Locus ID 7518
Cytogenetics 5q14.2
Protein Families Druggable Genome
Protein Pathways Non-homologous end-joining
MW 37.9 kDa
Gene Summary The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternative splicing generates several transcript variants. [provided by RefSeq, Dec 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.