PTGES2 (NM_198938) Human Tagged ORF Clone

SKU
RC212433
PTGES2 (Myc-DDK-tagged)-Human prostaglandin E synthase 2 (PTGES2), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PTGES2
Synonyms C9orf15; GBF-1; GBF1; mPGES-2; PGES2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212433 representing NM_198938
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGCTGTGAACGAGCAGGGCAAGGAGGTGACCGAGTTCGGCAATAAGTACTGGCTCATGCTCAACG
AGAAGGAGGCCCAGCAAGTGTATGGTGGGAAGGAGGCCAGGACGGAGGAGATGAAGTGGCGGCAGTGGGC
GGACGACTGGCTGGTGCACCTGATCTCCCCCAATGTGTACCGCACGCCCACCGAGGCTCTGGCGTCCTTT
GACTACATTGTCCGCGAGGGCAAGTTCGGAGCCGTGGAGGGTGCCGTGGCCAAGTACATGGGTGCAGCGG
CCATGTACCTCATCAGCAAGCGACTCAAGAGCAGGCACCGCCTCCAGGACAACGTGCGCGAGGACCTCTA
TGAGGCTGCTGACAAGTGGGTGGCTGCTGTGGGCAAGGACCGGCCCTTCATGGGGGGCCAGAAGCCGAAT
CTCGCTGATTTGGCGGTGTATGGCGTGCTGCGTGTGATGGAGGGGCTGGATGCATTCGATGACCTGATGC
AGCACACGCACATCCAGCCCTGGTACCTGCGGGTGGAGAGGGCCATCACCGAGGCCTCCCCAGCGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212433 representing NM_198938
Red=Cloning site Green=Tags(s)

MKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASF
DYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPN
LADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAITEASPAH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198938
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198938.1, NP_945176.1
RefSeq Size 1642 bp
RefSeq ORF 561 bp
Locus ID 80142
UniProt ID Q9H7Z7
Cytogenetics 9q34.11
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
MW 21.2 kDa
Summary The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE). Multiple transcript variants have been found for this gene. [provided by RefSeq, Jun 2009]
Write Your Own Review
You're reviewing:PTGES2 (NM_198938) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212433L3 Lenti ORF clone of Human prostaglandin E synthase 2 (PTGES2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC212433L4 Lenti ORF clone of Human prostaglandin E synthase 2 (PTGES2), transcript variant 2, mGFP tagged 10 ug
$600.00
RG212433 PTGES2 (tGFP-tagged) - Human prostaglandin E synthase 2 (PTGES2), transcript variant 2 10 ug
$500.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.