PTP4A3 (NM_032611) Human Tagged ORF Clone
CAT#: RC212193
PTP4A3 (Myc-DDK-tagged)-Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_032611" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | PTP4A3 |
Synonyms | PRL-3; PRL-R; PRL3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC212193 representing NM_032611
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCGGATGAACCGCCCGGCCCCGGTGGAGGTGAGCTACAAACACATGCGCTTCCTCATCACCCACA ACCCCACCAACGCCACGCTCAGCACCTTCATTGAGGACCTGAAGAAGTACGGGGCTACCACTGTGGTGCG TGTGTGTGAAGTGACCTATGACAAAACGCCGCTGGAGAAGGATGGCATCACCGTTGTGGACTGGCCGTTT GACGATGGGGCGCCCCCGCCCGGCAAGGTAGTGGAAGACTGGCTGAGCCTGGTGAAGGCCAAGTTCTGTG AGGCCCCCGGCAGCTGCGTGGCTGTGCACTGCGTGGCGGGCCTGGGCCGGGCTCCAGTCCTTGTGGCGCT GGCGCTTATTGAGAGCGGGATGAAGTACGAGGACGCCATCCAGTTCATCCGCCAGAAGCGCCGCGGAGCC ATCAACAGCAAGCAGCTCACCTACCTGGAGAAATACCGGCCCAAACAGAGGCTGCGGTTCAAAGACCCAC ACACGCACAAGACCCGGTGCTGCGTTATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC212193 representing NM_032611
Red=Cloning site Green=Tags(s) MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGA INSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_032611 |
ORF Size | 519 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032611.1, NP_116000.1 |
RefSeq Size | 1396 bp |
RefSeq ORF | 522 bp |
Locus ID | 11156 |
UniProt ID | O75365 |
Cytogenetics | 8q24.3 |
Protein Families | Druggable Genome, Phosphatase |
MW | 19.4 kDa |
Gene Summary | This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC212193L1 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, Myc-DDK-tagged |
USD 750.00 |
|
RC212193L2 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, mGFP tagged |
USD 750.00 |
|
RC212193L3 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, Myc-DDK-tagged |
USD 750.00 |
|
RC212193L4 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, mGFP tagged |
USD 750.00 |
|
RG212193 | PTP4A3 (tGFP-tagged) - Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1 |
USD 650.00 |
|
SC308739 | PTP4A3 (untagged)-Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1 |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review