UTF1 (NM_003577) Human Tagged ORF Clone

CAT#: RC211682

UTF1 (Myc-DDK-tagged)-Human undifferentiated embryonic cell transcription factor 1 (UTF1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_003577" in other vectors (6)

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal anti-UTF1 antibody
    • 100 ul

USD 539.00

Other products for "UTF1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UTF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211682 representing NM_003577
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTCCGGCCCCGCAGGCCGCCCCCGCTCGCGCCCCCCGCGCCGCCCTCGCCCGCCAGCCCCGACC
CCGAGCCGCGGACACCCGGAGACGCCCCGGGGACCCCGCCCCGGAGGCCCGCCTCGCCCAGCGCGCTGGG
GGAACTCGGGTTGCCGGTGTCCCCGGGCTCGGCGCAGCGCACGCCCTGGAGCGCCCGGGAGACGGAGCTG
CTGCTGGGGACGCTGCTGCAACCGGCCGTGTGGCGCGCGCTGCTCCTGGACCGCCGCCAGGCCCTGCCCA
CCTACCGCCGCGTGTCGGCCGCGCTGGCCCAGCAGCAGGTGCGCCGCACCCCCGCGCAGTGCCGCCGCCG
CTACAAGTTCCTTAAAGACAAGTTTCGCGAGGCGCACGGCCAGCCGCCCGGGCCCTTCGACGAGCAGATC
CGGAAGCTCATGGGGCTGCTGGGCGACAACGGGCGCAAACGGCCTCGCCGCCGCTCCCCGGGGTCCGGGC
GCCCCCAGCGCGCCCGCCGCCCGGTCCCCAACGCGCACGCGCCGGCTCCCAGCGAACCAGACGCCACCCC
GCTGCCCACCGCCCGCGACCGCGACGCGGACCCCACCTGGACGCTCCGCTTCAGCCCGTCCCCACCGAAG
TCTGCGGACGCCTCCCCCGCCCCCGGCTCCCCGCCAGCTCCCGCCCCGACCGCCCTCGCCACCTGCATCC
CCGAGGACCGCGCGCCCGTCCGCGGCCCCGGGTCCCCGCCGCCACCCCCGGCCCGCGAAGACCCCGACTC
GCCGCCCGGCCGCCCCGAGGACTGCGCGCCCCCTCCGGCCGCGCCCCCGTCGCTGAACACCGCCCTGCTG
CAGACCCTGGGGCACCTGGGCGACATCGCGAACATCCTGGGCCCGCTGCGCGACCAGCTGCTGACCTTGA
ACCAGCACGTGGAGCAGCTGCGCGGCGCCTTCGACCAGACAGTGTCCCTGGCCGTGGGCTTCATTCTGGG
CAGCGCGGCCGCCGAGCGAGGGGTCCTCAGGGACCCGTGCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211682 representing NM_003577
Red=Cloning site Green=Tags(s)

MLLRPRRPPPLAPPAPPSPASPDPEPRTPGDAPGTPPRRPASPSALGELGLPVSPGSAQRTPWSARETEL
LLGTLLQPAVWRALLLDRRQALPTYRRVSAALAQQQVRRTPAQCRRRYKFLKDKFREAHGQPPGPFDEQI
RKLMGLLGDNGRKRPRRRSPGSGRPQRARRPVPNAHAPAPSEPDATPLPTARDRDADPTWTLRFSPSPPK
SADASPAPGSPPAPAPTALATCIPEDRAPVRGPGSPPPPPAREDPDSPPGRPEDCAPPPAAPPSLNTALL
QTLGHLGDIANILGPLRDQLLTLNQHVEQLRGAFDQTVSLAVGFILGSAAAERGVLRDPCQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003577
ORF Size 1023 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003577.3
RefSeq Size 1157 bp
RefSeq ORF 1026 bp
Locus ID 8433
UniProt ID Q5T230
Cytogenetics 10q26.3
Protein Families Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors
MW 36.3 kDa
Gene Summary The protein encoded by this gene is a leucine zipper-containing transcriptional coactivator that may link the upstream activator ATF2 with the basal transcription complex. The encoded protein is closely associated with chromatin and is required for the proper differentiation of embryonic carcinoma and embryonic stem cells. Found nearly exclusively in pluripotent cells, this protein can also serve as a transcriptional repressor. [provided by RefSeq, Nov 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.