KCNE2 (NM_172201) Human Tagged ORF Clone
CAT#: RC211320
KCNE2 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_172201" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | KCNE2 |
Synonyms | ATFB4; LQT5; LQT6; MIRP1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC211320 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTACTTTATCCAATTTCACACAGACGCTGGAAGACGTCTTCCGAAGGATTTTTATTACTTATATGG ACAATTGGCGCCAGAACACAACAGCTGAGCAAGAGGCCCTCCAAGCCAAAGTTGATGCTGAGAACTTCTA CTATGTCATCCTGTACCTCATGGTGATGATTGGAATGTTCTCTTTCATCATCGTGGCCATCCTGGTGAGC ACTGTGAAATCCAAGAGACGGGAACACTCCAATGACCCCTACCACCAGTACATTGTAGAGGACTGGCAGG AAAAGTACAAGAGCCAAATCTTGAATCTAGAAGAATCGAAGGCCACCATCCATGAGAACATTGGTGCGGC TGGGTTCAAAATGTCCCCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC211320 protein sequence
Red=Cloning site Green=Tags(s) MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVS TVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_172201 |
ORF Size | 369 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_172201.2 |
RefSeq Size | 809 bp |
RefSeq ORF | 372 bp |
Locus ID | 9992 |
UniProt ID | Q9Y6J6 |
Cytogenetics | 21q22.11 |
Protein Families | Druggable Genome, Transmembrane |
MW | 14.5 kDa |
Gene Summary | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC211320L1 | Lenti ORF clone of Human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2), Myc-DDK-tagged |
USD 450.00 |
|
RC211320L2 | Lenti ORF clone of Human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2), mGFP tagged |
USD 450.00 |
|
RC211320L3 | Lenti ORF clone of Human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2), Myc-DDK-tagged |
USD 450.00 |
|
RC211320L4 | Lenti ORF clone of Human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2), mGFP tagged |
USD 450.00 |
|
RG211320 | KCNE2 (tGFP-tagged) - Human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2) |
USD 350.00 |
|
SC306737 | KCNE2 (untagged)-Human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review